1BJ4,1EJI,1KL2,1DFO,2DKJ


Conserved Protein Domain Family
SHMT

?
cd00378: SHMT 
Click on image for an interactive view with Cn3D
Serine-glycine hydroxymethyltransferase (SHMT). This family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). SHMT carries out interconversion of serine and glycine; it catalyzes the transfer of hydroxymethyl group of N5, N10-methylene tetrahydrofolate to glycine resulting in the formation of serine and tetrahydrofolate. Both eukaryotic and prokaryotic SHMT enzymes form tight obligate homodimers; the mammalian enzyme forms a homotetramer comprising four pyridoxal phosphate-bound active sites.
Statistics
?
PSSM-Id: 99733
View PSSM: cd00378
Aligned: 34 rows
Threshold Bit Score: 393.106
Threshold Setting Gi: 26541523
Created: 6-Mar-2002
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 4 residues -Click on image for an interactive view with Cn3D
Feature 1:active site [active site]
Evidence:
  • Comment:active site region binds glycine, pyridoxal phosphate, and folate
  • Structure:1EJI; Serine Hydroxymethyltransferase
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                #                                                    
1BJ4_A     17 KDSDVEVYNIIKKESNRQRV-GLELIASENFASRAVLEALGSCLNNKYSEGYPGQRYYGGTEFIDELETLCQKRALQAYK 95  human
1EJI_A     21 KDSDAEVYSIIKKESNRQRV-GLELIASENFASRAVLEALGSSLNNKYSEGYPGQRYYGGTEFIDELEXLCQKRALQAYH 99  house mouse
O84439     33 LHAFPSIGQSIVQELKSQRS-RLKMIASENFSSLSVQLAMGNLLTDKYCEGSPFKRFYSCCENVDAIEWECAETAKELFG 111 Chlamydia trachomatis
Q8TZ19      4 LEDVHSVVRAVEKHHEWLKK-CLPMIASENVTSPAVREMLVTDFGHRYAEGKPGERLYEGCEYIDEVELACVRLAKELFG 82  Methanopyrus kandleri
Q9HI38      3 YEDAEYIREMAMKHSEMFGE-GIALIASENVMSPLAKEVMISDLESRYAEGLPHHRYYQGNYYVDLIEDRTNELLSKLFR 81  Thermoplasma acido...
Q9UWT5      4 PKELEKVLEITKAQNVWRRTqTLNLIASENVMSPLAESVYMSDFMSRYAEGKPYKRYYQGTKYTDEIETLTMELMNEITN 83  Sulfolobus solfata...
Q8ZYF9      3 PREIEELLNIILQHNTWRRKeTINLIASENVMSPLAELVYVNDFAGRYAEGTVGNRYYQGTKYVDILEDSLSKRFAKVLD 82  Pyrobaculum aeroph...
O59347      4 REYRDKVLHFIEEHEKWRSH-TINLIASENITSPSVNRAVASGFMHKYAEGWPKQRYYQGCKYVDEVELIGVELFTKLFK 82  Pyrococcus horikoshii
Q58992      4 SDVPKFIRDVSIKQHEWMRE-SIKLIASENITSLAVREACATDFMHRYAEGLPGKRLYQGCKYIDEVETLCIELSKELFK 82  Methanocaldococcus...
EAA19589   12 EKSDKELYSILLDEEKRQKE-TINLIASENLINASVKECLGHVVSNKYSEGYPRKRYYGGNDYIDKIEELCCKRALETFN 90  Plasmodium yoelii ...
Feature 1                                                                              #      
1BJ4_A     96 LdpqcwGVNVQPYSGSPANFAVYTALVEPHG-------------------------------RIMGLDLPDGGHLTHGFm 144 human
1EJI_A    100 LdpqcwGVNVQPYSGSPANFAVYTALVEPHG-------------------------------RIXGLDLPDGGHLTHGFx 148 house mouse
O84439    112 Ae----SAFVQPHSGADANLLAIMSIITQKIqspavqrlgyktindlpeqeyealkaemaqhKCLGPSLNSGGHLTHGTv 187 Chlamydia trachomatis
Q8TZ19     83 Ae----HANVQPTSGVVANLAALFALTEPGD-------------------------------TILGLRISHGGHISHHDi 127 Methanopyrus kandleri
Q9HI38     82 Ts----QTDPRPISGTNANSAAIYALAGPGD-------------------------------LVATPSLSGGGHISAAEf 126 Thermoplasma acido...
Q9UWT5     84 Sk----DCDLRPTSGTIANAAVFRVLAEPGD-------------------------------KALIAPVQAGAHVSHTKf 128 Sulfolobus solfata...
Q8ZYF9     83 Ak----FVDVRPISGTIANLATYHALVPEGG-------------------------------IVASLPVKYGGHISHNTv 127 Pyrobaculum aeroph...
O59347     83 Sd----YADLRPVSGTNANQAVFFGLGQPGD-------------------------------KVIVLHTSHGGHISHMPf 127 Pyrococcus horikoshii
Q58992     83 Ae----HANVQPTSGVVANLAVFFAETKPGD-------------------------------KLMALSVPDGGHISHWKv 127 Methanocaldococcus...
EAA19589   91 LnseewGVNVQSLSGSAANVQALYALVGIKG-------------------------------KILGMHLCSGGHLTHGFf 139 Plasmodium yoelii ...
Feature 1                                                                                     
1BJ4_A    145 tdkkkISATSIFFESMPYKVNpdTGYINYDQLEENARLFHPKLIIAGTSCYSRNLEYARLRKIADENGAYLMADMAHISG 224 human
1EJI_A    149 tdkkkISATSIFFESXPYKVYpeTGYINYDQLEENASLFHPKLIIAGTSCYSRNLDYARLRKIADDNGAYLXADXAHISG 228 house mouse
O84439    188 ----rMNIMSKLMHCLPYEVNldTELFDYDEIAKIAKEHKPTVLIAGYSSYSRRLNFATLKQIAEDCGAVLWVDMAHFAG 263 Chlamydia trachomatis
Q8TZ19    128 s---aPGVRGLNVEYLPFDEE--DMAIDVDGMVRKIEEVEPSVVMLGASLFLFPHPVEEAVEAVEAVGGYVVYDAAHVLG 202 Methanopyrus kandleri
Q9HI38    127 g---iLGMRSVRTINYPYDMD--TMTIDPDQASKMIIKEKPKVCLFGQSVFMFPAPLKEMAEAFHEVGCKVWYDGAHVLG 201 Thermoplasma acido...
Q9UWT5    129 g---tLGALGIQHIEMPFDEE--NINVDVDKAIKMIEEVKPKFVVLGGSLYLFPHPTKELAQHVHAVGAKLVYDAAHVYG 203 Sulfolobus solfata...
Q8ZYF9    128 g---gLKALRVKTVELPWDFE--NFNIDIDAARKIIEEKRPNLIILGASLYLFPHPVREIANAAKAVGAYVLHDSAHVFG 202 Pyrobaculum aeroph...
O59347    128 g---aAGMRGLEVHTWPFDFE--SFNIDVDKAEKMIRELEPKIVVFGGSLFPFPHPVKELAPVAKEVGAFVVYDAAHVLG 202 Pyrococcus horikoshii
Q58992    128 s---aAGIRGLKVINHPFDPE--EMNIDADAMVKKILEEKPKLILFGGSLFPFPHPVADAYEAAQEVGAKIAYDGAHVLG 202 Methanocaldococcus...
EAA19589  140 dekkkVSVTSDMFESKLYKSNs-EGYVDLDVVREMALSFKPNVIICGYSSYPRDLDYKRFREIADEVNAYLLADIAHISS 218 Plasmodium yoelii ...
Feature 1                              #                                                      
1BJ4_A    225 LVAAGVVPSPFE---HCHVVTTTTHKTLRGCRAGMIFYRkgvksvdpatgkeilynLESLINSAVFPGLQGGPHNHAIAG 301 human
1EJI_A    229 LVAAGVVPSPFE---HCHVVTTTTHKTLRGCRAGXIFYRkgvrsvdpktgketyyeLESLINSAVFPGLQGGPHNHAIAG 305 house mouse
O84439    264 LVAGGVFVGEENpmpYADIVTTTTHKTLRGPRGGLVLAKk----------------EYANTLNKACPLMMGGPLPHVIAA 327 Chlamydia trachomatis
Q8TZ19    203 LIAGGQFQDPIRe--GAHVVTGSTHKTFPGPQGGIVLCQr---------------dLADDIDEAVFPGLVSNHHLHHVAA 265 Methanopyrus kandleri
Q9HI38    202 LIAGGRFQDPLRe--GADIVTGSTHKTFPGPQHGVILGNtd-------------deTWKAVRRAVFPGVLSNHHLNAMAA 266 Thermoplasma acido...
Q9UWT5    204 LIEGKVWSNPLKd--GADIMTVSTHKTFPGPQGGAIFSDgs--------------eVFKQVSKTIFPWFVSNHHLHRLPA 267 Sulfolobus solfata...
Q8ZYF9    203 LIIGGVFPNPLKe--GAHVITSSTHKTFPGPQGGLIASVtd-------------eeLNNAIQRAVFPVFTSNYHLHRYAA 267 Pyrobaculum aeroph...
O59347    203 LIAGGEFQDPLRe--GADIMTASTHKTFPGPQGGVILYKkfa-----------ddeTIAKLQWAIFPGVVSNHHLHHMAG 269 Pyrococcus horikoshii
Q58992    203 LIAGKQFQDPLRe--GAEYLMGSTHKTFFGPQGGVILTTk---------------eNADKIDSHVFPGVVSNHHLHHKAG 265 Methanocaldococcus...
EAA19589  219 FIACGNLNNPFL---YADVVTTTTHKILRGPRSAMIFFNkkr-----------npgIEQKINSSVFPSFQGGPHNNKIAA 284 Plasmodium yoelii ...
Feature 1                                                                                     
1BJ4_A    302 VAVALKQAMTlEFKVYQHQVVANCRALSEALTELGYKIVTGGSD---NHLILVDLRsk-gTDGGRAEKV--LEACSIACN 375 human
1EJI_A    306 VAVALKQAXTtEFKIYQLQVLANCRALSDALTELGYKIVTGGSD---NHLILXDLRsk-gTDGGRAEKV--LEACSIACN 379 house mouse
O84439    328 KAIALKEAMTiNFRKYAHKVVENARTLAEVFQRNGLRLLTGGTD---NHMLIIDLTsl-gVPGRIAEDM--LTSVGIAVN 401 Chlamydia trachomatis
Q8TZ19    266 LAVALAEFKE-YGERYARDTVRNAKALAEALYAEGLRVLCEHRGfteSHQIAVDVR----EQGGGAVIAekLESANILCN 340 Methanopyrus kandleri
Q9HI38    267 LGITAAEELE-FGKRYADDIISNAKVLAEELYANGFNVLAEKRGfteSHTMAVDVS----KNGGGKYVAetLEKCGIILN 341 Thermoplasma acido...
Q9UWT5    268 TAVTAIEMKY-FGESYANQILRNSKALAEALAERGFKVIGENLGytkSHQVAVDVR----QFGGGNKIAklLEDANIIVN 342 Sulfolobus solfata...
Q8ZYF9    268 TYVTLIEMEH-FGAEYGARIVENAKALAEALAEEGVTPVGERLGytkTHQVAVDVS----KFGGGDKVArlLEEANIIVN 342 Pyrobaculum aeroph...
O59347    270 KVITAAEMLE-YGEAYAKQIVKNAKALAEALAEEGFKVIGEDQGytkSHQVIVDVSdlhpAGGGWAAPL--LEEAGIILN 346 Pyrococcus horikoshii
Q58992    266 LAIALAEMLE-FGEAYAKQVIKNAKALAQALYERGFNVLCEHKDfteSHQVIIDIEsspdIEFSASELAkmYEEANIILN 344 Methanocaldococcus...
EAA19589  285 VACQLKEVQTeSFKNYTKQVLENSKALAKFLINNNIDLVTNGTD---NHIVLIDLRky-gITGSKLQEV--CNTINISIN 358 Plasmodium yoelii ...
Feature 1                       #                                                             
1BJ4_A    376 KNTCPGdrs--alrPSGLRLGTPALTSRGLLEKDFQKVAHFIHRGIELtlqiqsdtgvaatlk-efkerlagdkyqaavQ 452 human
1EJI_A    380 KNTCPGdks--alrPSGLRLGTPALTSRGLLEEDFQKVAHFIHRGIELtlqiqshxatkatlkefkeklagdekiqsavA 457 house mouse
O84439    402 RNTIPSdasg-qwkTSGIRLGTPALTTLGMGSAEMEEVANIIVKVLRNitvrsnaesgss--------ksegelsegiaQ 472 Chlamydia trachomatis
Q8TZ19    341 KNLLPWddeskshdPSGIRLGTQELTRLGMGLSEMEYIAELIADVVLGrr---------------------------epS 393 Methanopyrus kandleri
Q9HI38    342 KNLLPWddnkksqnPSGIRIGVQEATRVGMGKSEMKEIASLITRAIIRhe---------------------------dpE 394 Thermoplasma acido...
Q9UWT5    343 KNLLPYdkpedvsdPSGLRIGVQEMTRYGMKEGEMEEIAELFKKVIIDkk---------------------------dvN 395 Sulfolobus solfata...
Q8ZYF9    343 KNALPWdks--vlkPSGIRMGVQEMTRFGMGKGEMKEIAKFIARVLKGedpta---------------------vkrevV 399 Pyrobaculum aeroph...
O59347    347 KNLLPWdplekvnePSGLRIGVQEMTRVGMMEDEMKEIAHFMKRVLIDke---------------------------dpK 399 Pyrococcus horikoshii
Q58992    345 KNLLPWddvnnsdnPSGIRLGTQECTRLGMKEKEMEEIAEFMKRIAIDke---------------------------kpE 397 Methanocaldococcus...
EAA19589  359 KNTIPSdnd--cvsPNGARLGTPAMTTRGAKENDMKFIADTLLKAIKIaaslqekygkklv------efkkgltnnpelD 430 Plasmodium yoelii ...
Feature 1              
1BJ4_A    453 ALREEVESF 461 human
1EJI_A    458 TLREEVENF 466 house mouse
O84439    473 EARQRVADL 481 Chlamydia trachomatis
Q8TZ19    394 EVRKDVEEL 402 Methanopyrus kandleri
Q9HI38    395 KIKAEVKQL 403 Thermoplasma acidophilum
Q9UWT5    396 EVKKEVIEM 404 Sulfolobus solfataricus
Q8ZYF9    400 EFRKTFIEI 408 Pyrobaculum aerophilum
O59347    400 KVRKDVYYF 408 Pyrococcus horikoshii
Q58992    398 KVREDVKEF 406 Methanocaldococcus jannaschii
EAA19589  431 ALKKEVVQW 439 Plasmodium yoelii yoelii

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap