1DQU,1F8M,1F8I,2DUA,1MUM,1XG3,1IGW,1M1B,3B8I,1ZLP,1F61,1PYM,2HRW,1UJQ,1S2U,2QIW


Conserved Protein Domain Family
ICL_PEPM

?
cd00377: ICL_PEPM 
Click on image for an interactive view with Cn3D
Members of the ICL/PEPM enzyme family catalyze either P-C or C-C bond formation/cleavage. Known members are phosphoenolpyruvate mutase (PEPM), phosphonopyruvate hydrolase (PPH), carboxyPEP mutase (CPEP mutase), oxaloacetate hydrolase (OAH), isocitrate lyase (ICL), and 2-methylisocitrate lyase (MICL). Isocitrate lyase (ICL) catalyzes the conversion of isocitrate to succinate and glyoxylate, the first committed step in the glyoxylate pathway. This carbon-conserving pathway is present in most prokaryotes, lower eukaryotes and plants, but has not been observed in vertebrates. PEP mutase (PEPM) turns phosphoenolpyruvate (PEP) into phosphonopyruvate (P-pyr), an important intermediate in the formation of organophosphonates, which function as antibiotics or play a role in pathogenesis or signaling. P-pyr can be hydrolyzed by phosphonopyruvate hydrolase (PPH) to from pyruvate and phosphate. Oxaloacetate acetylhydrolase (OAH) catalyzes the hydrolytic cleavage of oxaloacetate to form acetate and oxalate, an important pathway to produce oxalate in filamentous fungi. 2-methylisocitrate lyase (MICL) cleaves 2-methylisocitrate to pyruvate and succinate, part of the methylcitrate cycle for the alpha-oxidation of propionate.
Statistics
?
PSSM-Id: 119340
View PSSM: cd00377
Aligned: 236 rows
Threshold Bit Score: 115.278
Threshold Setting Gi: 19111859
Created: 6-Mar-2002
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 13 residues -Click on image for an interactive view with Cn3D
Feature 1:active site [active site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                              # ###              #                      
1DQU_A        59 LWGILErnfknkEASFTYGCLDPTMVTQMAK--YLDTVYVSGWQSSSTasstdepSPDlADYPmNTVPNKVNHLWMAqlf 136 Aspergillus nid...
1F8I_A        57 LWEQLHd----lEWVNALGALTGNMAVQQVRa-GLKAIYLSGWQVAGDanlsghtYPDqSLYPaNSVPQVVRRINNAlqr 131 Mycobacterium t...
ZP_02838862   13 LKALHEa----pEILQVVNVWDAISAATVAAlpETKAIATAGHSIAAAl-----gYADgAMPL-DVALEGAKRIVDAv-- 80  Arthrobacter ch...
CAP65511      48 KSLHHTp----tKPLLLANAYDATSARIIASlpGCRALATASYALALSi-----gKADeTLTL-EDNISLCRPIAAVahe 117 Podospora anserina
2QIW_A        12 FASDHEs----gKLLVLPTVWDTWSAGLVEEa-GFSGLTIGSHPVADAt-----gSSDgENXNfADYXAVVKKITSAv-- 79  Corynebacterium...
ZP_02191285   13 LKSLLEt----gKTIMVPGCHDALSAMLVAEa-GFEVGYVGSYATAAAdl----gLPDvGALGlDDLVHRARRVADAv-- 81  alpha proteobac...
YP_001362710  10 LRQLHEd----pELLVLVNVWDAVSATVVAGepRTRALATAGHSIAATf-----gYGDgEQIPlDLALSLVERIVGAag- 79  Kineococcus rad...
YP_001705134  12 LKSLHVp----gDPVFLPTVWDAWSAKLAADa-GFAALTVGSHPLADSv-----gKADaEGMSfDDVVARVSQITAAv-- 79  Mycobacterium a...
YP_830397     12 LLRLHQa----pEILQVINVWDAITAKVATDvpGTTALATASHSIAASl-----gYEDgENIPaNLMIEAAGRIAASt-- 80  Arthrobacter sp...
ZP_00378928   14 LLEAHHq----dRPIVLPTVWDAWSAQAMVNd-GFEALSIGSHPLADSv-----gSADgETMSlSQALAGIARVCGSv-- 81  Brevibacterium ...
Feature 1                                       # #                              #               
1DQU_A       137 hdrkqreermttpkdqrhkvanvdylRPIIADADTGHGgl---taVMKLTKLFVE-RGAAGIHIEDQapgtkkcghmagk 212 Aspergillus nid...
1F8I_A       132 adqiaki---------egdtsvenwlAPIVADGEAGFGga---lnVYELQKALIA-AGVAGSHWEDQlasekksghlggk 198 Mycobacterium t...
ZP_02838862   81 -------------------------dLPVTADLDDGYQd------PAETIRRAIG-LGIAGANVEDRlr----------- 117 Arthrobacter ch...
CAP65511     118 ------------------------fnLPLTVDIQDGYAgpgdhaeLRSVIEKVILeLGAVGVNLEDTwhests------g 167 Podospora anserina
2QIW_A        80 -------------------------sIPVSVDVESGYGl-----sPADLIAQILE-AGAVGINVEDVvhsegk------- 121 Corynebacterium...
ZP_02191285   82 -------------------------aVPVVADAEGGFHep---gnIWRTVRAFEE-AGVAAIHIEDHaggkhtdl---pq 129 alpha proteobac...
YP_001362710  80 -------------------------dLPVSADLDGGFGn------AGETVRKAIG-VGVVGANVEDQlr----------- 116 Kineococcus rad...
YP_001705134  80 -------------------------dLPVSVDIESGYAq-----tAQRLIEGLIE-AGAVGLNIEDTvhsegg------- 121 Mycobacterium a...
YP_830397     81 -------------------------sLPVSADLESGYGs------PGETIQKAIG-VGIVGANIEDQmr----------- 117 Arthrobacter sp...
ZP_00378928   82 -------------------------dVPVSADLESGYDt-----aAPDLIAGLLE-AGAVGVNIEDTvhseg-------- 122 Brevibacterium ...
Feature 1                                       #                                                
1DQU_A       213 vlvpiSEHINRLVAIRAQAdim-gtdLLAIARTDSeaatlitstidhrdhpfiigstnpdiqplndlmvmaeqagkngae 291 Aspergillus nid...
1F8I_A       199 vliptQQHIRTLTSARLAAdva-dvpTVVIARTDAeaatlitsdvderdqpf---------------------------- 249 Mycobacterium t...
ZP_02838862  118 ---pfDEAVSRVAAIVRAAeae-gvpFQLNARTDAlvrggdr-------------------------------------- 155 Arthrobacter ch...
CAP65511     168 dmvpeDEAIERIKTVIRTArelgvvdFVVNARSDTflmg----------------------------------------- 206 Podospora anserina
2QIW_A       122 rvreaQEHADYIAAARQAAdva-gvdVVINGRTDAvklgad--------------------------------------- 161 Corynebacterium...
ZP_02191285  130 sliplESMIARLKAALEARrd---pnFQIIARTDAvwat----------------------------------------- 165 alpha proteobac...
YP_001362710 117 ---plAESVANVEAIVAAGeae-gvpFVLNARTDAlvrggdr-------------------------------------- 154 Kineococcus rad...
YP_001705134 122 rlrepQEHADLVGALRVAAdqs-gvpVVINARTDVllrqig--------------------------------------- 161 Mycobacterium a...
YP_830397    118 ---plADAVAQMAAAAQAGrae-gidFVLNARTDAflkgkdr-------------------------------------- 155 Arthrobacter sp...
ZP_00378928  123 rlrsaEEHAEYIGDLRRAAdaq-rvhVVINARTDVfknpdd--------------------------------------- 162 Brevibacterium ...
Feature 1                                                                                        
1DQU_A       292 lqaiedewlakaglklfndavvdainnsplpnkkaaiekyltqskgksnlearaiakeiagtdiyfdweaprtregyyry 371 Aspergillus nid...
1F8I_A       250 -------------------------------------------------------------------itgertregfyrt 262 Mycobacterium t...
ZP_02838862  156 ------------------------------------------------------------------------------pi 157 Arthrobacter ch...
CAP65511         --------------------------------------------------------------------------------     Podospora anserina
2QIW_A       162 ------------------------------------------------------------------------------vf 163 Corynebacterium...
ZP_02191285      --------------------------------------------------------------------------------     alpha proteobac...
YP_001362710 155 ------------------------------------------------------------------------------gr 156 Kineococcus rad...
YP_001705134 162 ------------------------------------------------------------------------------ee 163 Mycobacterium a...
YP_830397    156 ------------------------------------------------------------------------------dp 157 Arthrobacter sp...
ZP_00378928  163 -------------------------------------------------------------------------------f 163 Brevibacterium ...
Feature 1                                 #                              # #                     
1DQU_A       372 qggtQCAINRAVAYAPF--ADLIWMESkl---pdYKQAKEFadgvhavwpeqKLAYNLSpsfnwkkamprdeqetyiKRL 446 Aspergillus nid...
1F8I_A       263 kngiEPCIARAKAYAPF--ADLIWMETgt---pdLEAARQFseavkaeypdqMLAYNCSpsfnwkkhlddatiakfqKEL 337 Mycobacterium t...
ZP_02838862  158 qesiDDAIARGRAFLDAg-AALVFVPGal----tGEVIEPLvegl----grgKLSIIGApga------------lpaAQL 216 Arthrobacter ch...
CAP65511     207 -gslDESIRCGKRYLDEggAETVFIFWprnkemeKADVQKVide-----lggRVNVSCRlggq-----------lttGEL 269 Podospora anserina
2QIW_A       164 edpxVEAIKRIKLXEQAg-ARSVYPVGls----tAEQVERLvda-----vsvPVNITAHpvdgh--------gagdlATL 225 Corynebacterium...
ZP_02191285  166 -kdpEEALRRVRAFTAAg-ADMVFPTGa-----tPELIAGFrn-------evPARYVVIdgp-------------ghPRF 218 alpha proteobac...
YP_001362710 157 dvwlPDAIERGRAYLAAg-ATSVFVPGpl----dEDAVQQLvaa-----fgpQKLSVIGfpgv-----------pdqARL 215 Kineococcus rad...
YP_001705134 164 sdrvDRAIARLKLAAEAg-ADSLYPVGrh----dPDVQRRLtse-----lplPVNAIAVpdv------------ddpASF 221 Mycobacterium a...
YP_830397    158 advlADAIERGRAFLDVg-ATTVFVPGll----dEPTVAALvegi----grnKVSVINVpgs------------lapAKL 216 Arthrobacter sp...
ZP_00378928  164 edptAEVIRRLNLCAEAg-ADSVYPVRlp----nTETLKTIlsq-----vrlPLNVTAHpvkgav------pdeldlSQL 227 Brevibacterium ...
Feature 1                          #                 
1DQU_A       447 GAl--------gYAWQFITlagLHTTALISDTFAKA 474 Aspergillus nidulans
1F8I_A       338 AAm--------gFKFQFITlagFHALNYSMFDLAYG 365 Mycobacterium tuberculosis
ZP_02838862  217 QEl--------gVARVSYGpftQRVALRALRDLATD 244 Arthrobacter chlorophenolicus A6
CAP65511     270 GQm--------gAARVSVGpqvFLAAAEAIKKAAGA 297 Podospora anserina
2QIW_A       226 AGl--------gVRRVTFGplwQKWLAATSAQQLKG 253 Corynebacterium glutamicum ATCC 13032
ZP_02191285  219 AGretaaslvlyYGFTLFAa--TRGLTLALDRLRAE 252 alpha proteobacterium BAL199
YP_001362710 216 AEl--------gVARITYGpltQRVALTALQDAARG 243 Kineococcus radiotolerans SRS30216
YP_001705134 222 GPl--------gVGRISFGpffQRALSARAEEILGR 249 Mycobacterium abscessus
YP_830397    217 QEl--------gVARISYGpwtQRVALTAFADATAE 244 Arthrobacter sp. FB24
ZP_00378928  228 QDl--------gVKRVTFGpllQATMYDYFAKFTRN 255 Brevibacterium linens BL2

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap