1R6V,1THM,1CSE,2IY9,1IC6,1XF1,1R64,1GT9,1GA4,1WMD


Conserved Protein Domain Family
Peptidases_S8_S53

?
cd00306: Peptidases_S8_S53 
Click on image for an interactive view with Cn3D
Peptidase domain in the S8 and S53 families
Members of the peptidases S8 (subtilisin and kexin) and S53 (sedolisin) family include endopeptidases and exopeptidases. The S8 family has an Asp/His/Ser catalytic triad similar to that found in trypsin-like proteases, but do not share their three-dimensional structure and are not homologous to trypsin. Serine acts as a nucleophile, aspartate as an electrophile, and histidine as a base. The S53 family contains a catalytic triad Glu/Asp/Ser with an additional acidic residue Asp in the oxyanion hole, similar to that of subtilisin. The serine residue here is the nucleophilic equivalent of the serine residue in the S8 family, while glutamic acid has the same role here as the histidine base. However, the aspartic acid residue that acts as an electrophile is quite different. In S53, it follows glutamic acid, while in S8 it precedes histidine. The stability of these enzymes may be enhanced by calcium; some members have been shown to bind up to 4 ions via binding sites with different affinity. There is a great diversity in the characteristics of their members: some contain disulfide bonds, some are intracellular while others are extracellular, some function at extreme temperatures, and others at high or low pH values.
Statistics
?
PSSM-Id: 173787
View PSSM: cd00306
Aligned: 273 rows
Threshold Bit Score: 41.8016
Threshold Setting Gi: 149920985
Created: 3-Oct-2006
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
active sitecatalytic
Conserved site includes 3 residues -Click on image for an interactive view with Cn3D
Feature 1:active site [active site]
Evidence:
  • Structure:1GA4: Pseudomonas sp. Pscp binds Inhibitor Pseudoiodotyrostatin
    View structure with Cn3D
  • Structure:1R64: yeast Kex2 protease binds Ac-Arg-Glu-Lys-Boroarg peptidyl boronic acid inhibitor
    View structure with Cn3D
  • Comment:a few of the residues are conserved between S8 and S53

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                                                     #   
1R6V_A        156 IIVAVVDTGvdgthpd-------------------legqviAGYRpafdeelpa-------------gtdssyggSAGTH 203  Fervidobacter...
XP_001800404  191 TLVYVVDRGvqvdvrdvrpflqll--httflisykdksnklFSGFedvndrftiletr----afsnqnaahdkrtDYADG 264  Phaeosphaeria...
ZP_01694852    46 INIAMLDAGiestpdlvpvhpafqgaltdnddkvphfivlsGTGRfsfsn---------------------liygRHGVL 104  Microscilla m...
EAX02301       69 VVVTILDDGiernhpdlap------------nydsyasydvNGNDydpspry-----------------dasnenKHGTR 119  human
XP_001540220 1422 QHIYILEDGyykdhp--------------------efrgvdIELLfpddvnqqpw----------apevilsprvDHGAE 1471 Ajellomyces c...
XP_748781     117 TYVYHVDFGaqpshpefsdvs---------flhpllpgpypVSGWm----------------------------eNDPKR 159  Aspergillus f...
XP_001905631 1132 QDVYLIESGyqtdhp--------------------hflplrQNGHqetlprhl--------------sswwddnlVWYPD 1177 Podospora ans...
XP_001239727  793 IPVFIVDTGaqldhqe-------------------ftegdnIASKtefvfvekdydgqyhrddagvplngvcepgYCNPH 853  Coccidioides ...
CAB92026      278 QYIYNFDEGvnpdqdlnpnn-----------iekfhyeysiNNGRd-----------------------------MHNYI 317  Neurospora cr...
XP_001226229 1142 QYIYNMDAGingnse---------------------fsganIAYFdpeys--------------------inngiGLNSY 1180 Chaetomium gl...
Feature 1                                                                                         
1R6V_A        204 VAGTIAakkdgkgi-------------------------------vgvapgaKIMPIVifddpalvg----------gng 242  Fervidobacter...
XP_001800404  265 HGTKVAskv-----------------------------------------vgQWGTAKgatlvpvq------------vl 291  Phaeosphaeria...
ZP_01694852   105 TAGMAAakaqvnnvaaysgvgvv------------gvapnckvvsvsqrftsDFTVFR---------------------- 150  Microscilla m...
EAX02301      120 CAGEVAasannsycivgiaynakiggkaghgslraegpgagaagsslsaglsSLLFFGfghvttdlrqrc----tdghtg 195  human
XP_001540220 1472 VASKVVganlg------------------------------------fcdncKLHVAPffllgdlw-------------y 1502 Ajellomyces c...
XP_748781     160 HGSLCLske----------------------------------------vgkTVGIARkatvvata-------------w 186  Aspergillus f...
XP_001905631 1178 HPTGVGsvi----------------------------------------agrYTGVCPegkvrligtdvphrrwdegtds 1217 Podospora ans...
XP_001239727  854 GTGMLGmia-----------------------------------------gaNLGVAKkvkpwvvrvprk-----nkrgg 887  Coccidioides ...
CAB92026      318 HGTGVAyya----------------------------------------vgqTLGIAPgatflvmedppt-----mttnk 352  Neurospora cr...
XP_001226229 1181 DHGTQValya---------------------------------------igqSLGIAPra-------------------- 1201 Chaetomium gl...
Feature 1                                                                                 #       
1R6V_A        243 yvgddyVAAGIiwat-----------------------------------------------dhgaKVMNHSWGgwgy-- 273  Fervidobacter...
XP_001800404  292 vdefadLPDGFnqvwkdlrrr-----------------------------------kaqnrgqsiqAVVVCSVHvvpsqg 336  Phaeosphaeria...
ZP_01694852   151 ------DLAGLrqffikrdfagrkkvngllgypsiyd----vvvsprksddphqnayladlvnqtaDIFSMSIQapvde- 219  Microscilla m...
EAX02301      196 tsvsapMVAGIialaleansqltwrdvqhllvktsrpahlkasdwkvngaghkvshfygfglvdaeALVVEAKKwtavps 275  human
XP_001540220 1503 erlieqLMTIQnrvrrn--------------------------------------------gfqykAVINMSFDldd--- 1535 Ajellomyces c...
XP_748781     187 dfqksiNEHWLdalakvhad-------------------------------------istgargakSVVNLSISipqgdl 229  Aspergillus f...
XP_001905631 1218 pvwawmLIDALtttlgrvk----------------------------------------sngrgtkSVINMSFSmi---- 1253 Podospora ans...
XP_001239727  888 gftpqhFLEGVarvndmil----------------------------------------gdskttrAILSLSWSydsekf 927  Coccidioides ...
CAB92026      353 tghleiNLIRLlgmindie----------------------------------------skgrqgkCVINISMVwv---- 388  Neurospora cr...
XP_001226229 1202 ----tlVLMADdgtmdpdddqasd-----------------------------eivstlplrvyadAVVQCGCSvi---- 1244 Chaetomium gl...
Feature 1                                                                                         
1R6V_A        274 ---------sytmKEAFDYAMeh-----------------------------------gVVMVVSAgnntsdshh----- 304  Fervidobacter...
XP_001800404  337 g-----wtrqeaeAQFVGRMFskwikl---------------------------lheegVPIVLASgnfgdidkrdvid- 383  Phaeosphaeria...
ZP_01694852   220 --------stnkvEAFATLVFddltff--------------------------grkgrgCVLVVASgnngqvlevtag-- 263  Microscilla m...
EAX02301      276 qhmcvaasdkrprSIPLVQVLrttaltsacaehsdqrvvylehvvvrtsishprrgdlqIYLVSPSgtksqllakrlldl 355  human
XP_001540220 1536 ----------dvrEACLRRIHemlat----------------------------ldswgVSIVVAVgnvdpdfpdgvfyp 1577 Ajellomyces c...
XP_748781     230 t-----aaflekmALLIREIIkl-----------------------------------gAVFVTGSgnspgspngypal- 268  Aspergillus f...
XP_001905631 1254 -----------vfNEPMRNMLstllqq---------------------------ldslgVVIVVASgnhpdwhnadlvpp 1295 Podospora ans...
XP_001239727  928 i-----kgsdastDDFETWRVrfhgilr-------------------------tliqkgVFVVTGSgnnhivngw----- 972  Coccidioides ...
CAB92026      389 -----------vpEDATDRWLslfrmmir-----------------------ymetnlqCVVVIASgnvediqs------ 428  Neurospora cr...
XP_001226229 1245 -----------stTSSIPASWfldg-------------------------------qlpDLVVAASaskh---------- 1272 Chaetomium gl...
Feature 1                                                                                         
1R6V_A            --------------------------------------------------------------------------------      Fervidobacter...
XP_001800404      --------------------------------------------------------------------------------      Phaeosphaeria...
ZP_01694852       --------------------------------------------------------------------------------      Microscilla m...
EAX02301      356 snegftnwefmtvhcwgekaegqwtleiqdlpsqvrnpekqgklkewslilygtaehpyhtfsahqsrsrmlelsapele 435  human
XP_001540220      --------------------------------------------------------------------------------      Ajellomyces c...
XP_748781         --------------------------------------------------------------------------------      Aspergillus f...
XP_001905631 1296 p------------------------------------------------------------------------------- 1296 Podospora ans...
XP_001239727      --------------------------------------------------------------------------------      Coccidioides ...
CAB92026          --------------------------------------------------------------------------------      Neurospora cr...
XP_001226229      --------------------------------------------------------------------------------      Chaetomium gl...
Feature 1                                                                                         
1R6V_A            --------------------------------------------------------------------------------      Fervidobacter...
XP_001800404      --------------------------------------------------------------------------------      Phaeosphaeria...
ZP_01694852       --------------------------------------------------------------------------------      Microscilla m...
EAX02301      436 ppkaalspsqvevpedeedytgvchpecgdkgcdgpnadqclncvhfslgsvktsrkcvsvcplgyfgdtaarrcrrchk 515  human
XP_001540220      --------------------------------------------------------------------------------      Ajellomyces c...
XP_748781         --------------------------------------------------------------------------------      Aspergillus f...
XP_001905631      --------------------------------------------------------------------------------      Podospora ans...
XP_001239727      --------------------------------------------------------------------------------      Coccidioides ...
CAB92026          --------------------------------------------------------------------------------      Neurospora cr...
XP_001226229      --------------------------------------------------------------------------------      Chaetomium gl...
Feature 1                                                                                         
1R6V_A        305 --------------------------------------------------------------qypagypgVIQVAALdyy 322  Fervidobacter...
XP_001800404  384 ----------------------------------------------------------tlpavlatddvpLINVGATtve 405  Phaeosphaeria...
ZP_01694852   264 -----------------------------------------------------------qyrneyatsnkPIVVGATrvs 284  Microscilla m...
EAX02301      516 gcetcssraatqclscrrgfyhhqemntcvtlcpagfyadesqknclkchpsckkcvdepekctvckegfSLARGSCipd 595  human
XP_001540220 1578 --------------------------------------------------------alfgepgspfymenLIIVGETded 1601 Ajellomyces c...
XP_748781     269 ----------------------------------------------------------fgdpanpnhipeLIVVGSVlgq 290  Aspergillus f...
XP_001905631 1297 --------------------------------------------------------ardvwprgeaqvpnIILVGATdih 1320 Podospora ans...
XP_001239727  973 -------------------------------------------------------------palfgaepsTLKPELQanw 991  Coccidioides ...
CAB92026      429 --------------------------------------------------------------yanaavpaRWSLDGSlpd 446  Neurospora cr...
XP_001226229 1273 ------------------------------------------------------------------glraMHSVPWSdht 1286 Chaetomium gl...
Feature 1                                                                                         
1R6V_A        323 ggtfr-----------------------------vagfssrsDGVSVGApgvtilstvpgedsigyeghnenvpatnggt 373  Fervidobacter...
XP_001800404  406 gkawek---------------------------sqgqgsqdgTQLAIYApgvdvvvh-----------------dhidgk 441  Phaeosphaeria...
ZP_01694852   285 nhynhlvags-------------------npeesvatysnfgERLDIVApaggvasgfd-------------rrrsyttt 332  Microscilla m...
EAX02301      596 cepgtyfdselircgechhtcgtcvgpgreecihcaknfhfhDWKCVPAcgegfypee--------------mpglphkv 661  human
XP_001540220 1602 gnqg--------------------------------psglyrTWITTFApgygvwvp-----------------qtptgg 1632 Ajellomyces c...
XP_748781     291 gil---------------------------------gqhanaDWVTCYApgyglrmad--------------sdpesate 323  Aspergillus f...
XP_001905631 1321 gr-----------------------------------rgifsQACEVYAagvdvavsl---------------lgggddd 1350 Podospora ans...
XP_001239727  992 lhvpellvvgavd-------------vftgerwwksaidvdkGLPHIYApgkhvlgtqgnk---------gewrrdfegt 1049 Coccidioides ...
CAB92026      447 tlvv-------------------------------gfasnhgYRALGSLpwnidgrldd-------------ssmvfapa 482  Neurospora cr...
XP_001226229 1287 dt-----------------------------------gmvygPGLNLYQnggellhgtslaapmi-ssvvaylraldspf 1330 Chaetomium gl...
Feature 1                #                                                                
1R6V_A        374 yDYYQGTSMAAPHVTGVVAVLlqkfpn--------------------------------akpwqIRKLLENT 413  Fervidobacterium penn...
XP_001800404  442 eTRATGTSMAAPAVAGIIAVHmnyqpwgkd-------------------------ntglarvkeIRRWIQTP 488  Phaeosphaeria nodorum...
ZP_01694852   333 vWGAGQLSSESPLELTVVAGVsdt-------------------------------------eleLRNLHGVF 367  Microscilla marina AT...
EAX02301      662 cRRCDENCLSCAGSSRNCSRCktgftqlgtscitnhtcsnadetfcemvksnrlcerklfiqfcCRTCLLAG 733  human
XP_001540220 1633 yTVKAGTSLSAPLVSGLIAYYrsiqspwq---------------------------dqlkdpanVKKMIKIF 1677 Ajellomyces capsulatu...
XP_748781     324 yRTTQGTSFASATVAGLAAYFrgldst-------------------------------lttaasVKERILRL 364  Aspergillus fumigatus...
XP_001905631 1351 fEVVNGTSFAAPVVSGLVAYLralvaikdps-----------------------rlrefddpayVKEFIWSN 1399 Podospora anserina DS...
XP_001239727 1050 yKVEVGTSVATAYAAGLAAYFlrlhqvgrlgpd-------------------akgndpdmspagLKRYIINN 1102 Coccidioides immitis RS
CAB92026      483 sRLTVVRYAAAPMVAALVAYLralpspfaed------------------------lkktvfavkMVKYLTRK 530  Neurospora crassa
XP_001226229 1331 aNDLRNPVFAVKMVEYLARKVrviddtgti--------------------------dsdeeqegFHARIIWN 1376 Chaetomium globosum C...

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap