2BUK


Conserved Protein Domain Family
STNV

?
cd00259: STNV 
Click on image for an interactive view with Cn3D
STNV domain; satellite tobacco necrosis virus (STNV) are small plant viruses which are completely dependent on the presence of a specific helper virus, TNV, for their replication; 60 identical subunits, this domain is one of them; form an icosahedral shell around a single RNA molecule. Half of the RNA codes for the coat protein with the other half being non-coding. The STNV domain has a "Swiss roll" Greek key topology with its two 4-stranded antiparallel beta sheets
Links
?
Statistics
?
PSSM-Id: 119404
View PSSM: cd00259
Aligned: 4 rows
Threshold Bit Score: 280.989
Threshold Setting Gi: 116797
Created: 4-Sep-2001
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
Ca2+ bindingputative RNA
Conserved site includes 2 residues -Click on image for an interactive view with Cn3D
Feature 1:Ca2+ binding site [ion binding site]
Evidence:
  • Structure:2BUK: binds Ca2+
    View structure with Cn3D
  • Comment:two calcium ions are bound by this domain, the third calcium ion is bound by another domain (not shown)
  • Citation:PMID 6481804

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                             #                             #                         
2BUK_A      2 AKQQNNRRKSATMRAVKRMINTHLEHKRFALINSGNTNATAGTVQNLSNGIIQGDDINQRSGDQVRIVSHKLHVRGTAIT 81  Tobacco necrosis s...
2832896     7 RTQTTRSVRSLTTRDVRNIIRGEAETKRFVLVNTLNLNSTAGTVLNLSNGIIQGDDISQRAGDKIRMTKQILRVRATAIT 86  Satellite tobacco ...
116802      3 KRQSKQSNRKSVASQVRSIVESMAEQKRFAFLTNTNTVTTAGTVINLSNNIVQGDDLVNRTGDQIKTIHQTLLTRCTGIT 82  Satellite tobacco ...
116797     17 RKGSQPASKQDVKQVVKSILGQSLEHKRANLLLPPTVVNTTGNIYCLTQFVIEGDGISQRTGRVINLEQMVLRYRRTLDT 96  Satellite maize wh...
Feature 1                                                                                     
2BUK_A     82 V---SQTFRFIWFRDNMNRGTTPTVLEVLNTANFMSQYNPITLQQKRFTI-LKDVTLNC-SLTGESIKDRIINLPG-QLV 155 Tobacco necrosis s...
2832896    87 N---SQTFRFIWFKDNTNRGTTPSVTEVLNSASFMAQYNPVTLLQHRFTI-LKDVELDC-SLSGESIKHLVMTHGG-TSC 160 Satellite tobacco ...
116802     83 N---SQSFRFIWFRDNTNRGTTPAVTEVLDSASITSQYNPTTFQQKRFTV-FQDFMLDT-SIVGRVIVHRTAVDKKrRAI 157 Satellite tobacco ...
116797     97 TsanSGFLRYIVFLDTQNQGTLPAITDVLSSLDVSSGYEVLNAQQNRFKFlLDEVESLCaSATNLSKASTLTFNQK-VQV 175 Satellite maize wh...
Feature 1                                                
2BUK_A    156 NYNGATAVAASNGPGAIFMLQIGDSLv--GLWDSSYEAVYTDA 196 Tobacco necrosis satellite virus 1
2832896   161 FYNGTTAVASANGPGAIFLLVIGDSIv--GTWDVGYEAHYLDL 201 Satellite tobacco necrosis virus
116802    158 FYNGAASVAASNGPGATFVLVIGSHAt--GQYDVTAEIVYLDM 198 Satellite tobacco necrosis virus 2
116797    176 HYGGAADAATSNRRNAVFFLELSDKVatgPQTRLGVQLKFTDA 218 Satellite maize white line mosaic virus

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap