1J8R,1J8S


Conserved Protein Domain Family
PapG_CBD

?
cd00239: PapG_CBD 
Click on image for an interactive view with Cn3D
PapG carbohydrate / receptor binding domain (CBD); PapG, the adhesin of the P-pili, is situated at the tip, mediating the attachment of uropathogenic Escherichia coli to the uroepithelium of the human kidney; PapG has a two-domain architecture: a carbohydrate binding N-terminus (this domain) and chaperone binding C-terminus (C-terminal pilin region). The carbohydrate-binding domain interacts with the receptor glycan. There are 3 PapG alleles, class I-III, which bind to different receptor isotypes, GbO3, GbO4, and GbO5, respectively.
Statistics
?
PSSM-Id: 119414
View PSSM: cd00239
Aligned: 6 rows
Threshold Bit Score: 296.731
Threshold Setting Gi: 4240529
Created: 4-Sep-2001
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
receptor/carb..putative
Conserved site includes 13 residues -Click on image for an interactive view with Cn3D
Feature 1:receptor/carbohydrate binding site
Evidence:
  • Comment:globoside (GbO4) consists of the tetrasaccharide GalNAc(beta1)-3Gal(alpha1)-4Gal(beta1)-4Glc linked to ceramide
  • Comment:mutation of Trp to Ala abolishes receptor binding
  • Structure:1J8R_A, binds GbO4
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                                 ###                 
1J8R_A      1 WNNIVFYSLGDVNSYQGGNVVITQRPQFITSWRPG--IATVTWNQCNGPEFADgfwaYYREYIAWVVFPKKVXTqNGYPL 78  Escherichia coli
1J8S_A      1 WNNIVFYSLGDVNSYQGGNVVITQRPQFITSWRPG--IATVTWNQCNGPEFADgfwaYYREYIAWVVFPKKVXTqNGYPL 78  Escherichia coli
1172645    23 NQSTMFYSFNDNIYRPQLSVKVTDIVQFIVDINSAssTATLSYVACNGFTWTHg--lYWSEYFAWLVVPKHVSY-NGYNI 99  Escherichia coli
AAD13607   22 IQSTMFYSFNDNIYRPRLSVKVTDVIQIIVDINSAssTATLSYVDCNGFTWSHg--iYWSEYFAWLVVPKHVSY-NGYDI 98  Escherichia coli
12837502   23 WHNVMFYAFNDYSGYDSGNMTIFDRGQFTIPWKTG--AASAIYSSCQTPEFVSg--vYFQEYIAWVLVPRSTQTtDRYTV 98  Escherichia coli
129622     23 WHNVMFYAFNDYLTTNAGNVKVIDQPQLYIPWNTG--SATATYYSCSGPEFASg--vYFQEYLAWMVVPKHVYTnEGFNI 98  Escherichia coli
Feature 1                 #          ######                                                   
1J8R_A     79 FIEVHNKGSWSEEnTGDNDSYFFLKGYKWDERAfDAGNLCQKPGEITRLTEKFDDIIFKVALPADLPLGDYSVKIPYTSG 158 Escherichia coli
1J8S_A     79 FIEVHNKGSWSEEnTGDNDSYFFLKGYKWDERAfDAGNLCQKPGEITRLTEKFDDIIFKVALPADLPLGDYSVKIPYTSG 158 Escherichia coli
1172645   100 YLELQSRGSFSLD-AEDNDNYYLTKGFAWDEAN-TSGQTCFNIGEKRSLAWSFGGVTLNARLPVDLPKGDYTFPVKFLRG 177 Escherichia coli
AAD13607   99 YLELQSRGSFSLD-AEDNDNYYLTKGFAWDEAN-TSGRTCFNIGEKRSLAWSFGGVTLNARFPVDLPKGDYTFPVKFLRG 176 Escherichia coli
12837502   99 FFDVYSKYGWNQEnTGDYGYYYFLNGYEWDTWTsDGGRVCAPVGNTKQLSNTFNELRFSLLLPADLPKGRYEVPIKYIRG 178 Escherichia coli
129622     99 FLDVQSKYGWSMEnENDKDFYFFVNGYEWDTWTnNGARICFYPGNMKQLNNKFNDLVFRVLLPVDLPKGHYNFPVRYIRG 178 Escherichia coli
Feature 1                # #  #                     
1J8R_A    159 XQRHFASYLGARFKIPYNVAKTLPRENEXLFLFKNIGG 196 Escherichia coli
1J8S_A    159 XQRHFASYLGARFKIPYNVAKTLPRENEXLFLFKNIGG 196 Escherichia coli
1172645   178 IQRNNYDYIGGRYKIPSSLMKTFPFNGTLNFSIKNTGG 215 Escherichia coli
AAD13607  177 IQRNNYDYIGGRYKIPSSLMKTFPFNGTLNFSIKNTGG 214 Escherichia coli
12837502  179 IQHHYYNGWREHYKMPYSQVKQLPATNTLMLSFNNTGS 216 Escherichia coli
129622    179 IQHHYYDLWQDHYKMPYDQIKQLPATNTLMLSFDNVGG 216 Escherichia coli

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap