1HE1,1HE9,1G4U,1HY5


Conserved Protein Domain Family
ToxGAP

?
cd00219: ToxGAP 
Click on image for an interactive view with Cn3D
GTPase-activating protein (GAP) domain found in bacterial cytotoxins, ExoS, SptP, and YopE. Part of protein secretion system; stimulates Rac1- dependent cytoskeletal changes that promote bacterial internalization.
Statistics
?
PSSM-Id: 119405
View PSSM: cd00219
Aligned: 9 rows
Threshold Bit Score: 140.242
Threshold Setting Gi: 18655413
Created: 4-Sep-2001
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 4 residues -Click on image for an interactive view with Cn3D
Feature 1:GTP binding residues [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                  #                                     
1HE1_A        11 VLQQALPMTLKGLDKAse-lATLTPEGLAREHSRLASGDGALRSLSTALAGIRAgsQVEESRIQAGRLLERSIGGIALQQ 89  Pseudomonas aer...
1HE9_A         4 VLQQALPXTLKGLDKAse-lATLTPEGLAREHSRLASGDGALRSLSTALAGIRAgsQVEESRIQAGRLLERSIGGIALQQ 82  Pseudomonas aer...
1G4U_S         7 SKQPLLDIALKGLKRTlpqlEQMDGNSLRENFQEMASGNGPLRSLMTNLQNLNKipEAKQLNDYVTTLTNIQVGVARFSQ 86  Salmonella typh...
1HY5_A        13 FSDSIKQLAAETLPKYxqqlNSLDAEXLQKNHDQFATGSGPLRGSITQCQGLXQf-CGGELQAEASAILNTPVCGIPFSQ 91  Yersinia pestis
AAB07232     108 MLQKALPLTLGGLGKAse-lATLTAERLAKDHTRLASGDGALRSLATALVGIRDgsRIEASRTQAARLLEQSVGGIALQQ 186 Pseudomonas aer...
15077066     102 MKQAAFGSSLGGFAKAdv-lNNITGEQLGKDHASLATGNGPLRSLCTALQAVVIgsQQPQLRELATGLLARPIAGIPLQQ 180 Aeromonas salmo...
401663       102 FSDSIKQLAAETLPKYmqqlNSLDAEMLQKNHDQFATGSGPLRGSITQCQGLMQf-CGGELQAEASAILNTPVCGIPFSQ 180 Yersinia pestis
ABJ98887     104 FLQKALPYTLSALDKTse-lKSINAEQLRKDHTTLATGNGALRSLVTALSGIRDgsKIEATTHQAARLLELNLGGIALQQ 182 Aeromonas veronii
YP_002176542  84 VRLVARDSAFLGLQRAir-sERFELDNFKSNFPYLTVANGSLRTIVTGLKGIVEf-DDGQMKDIAKEILDTQICGVPFSQ 161 Vibrio cholerae...
Feature 1          ###                                    
1HE1_A        90 WGTTGGAASQLVLDASPelRREITDQLHQVMSEVALLRQAV 130 Pseudomonas aeruginosa
1HE9_A        83 WGTTGGAASQLVLDASPelRREITDQLHQVXSEVALLRQAV 123 Pseudomonas aeruginosa
1G4U_S        87 WGTCGGEVERWVDKASTheLTQAVKKIHVIAKELKNVTAEL 127 Salmonella typhimurium
1HY5_A        92 WGTIGGAASAYVASGVD--LTQAANEIKGLAQQXQKLLSLX 130 Yersinia pestis
AAB07232     187 WGTAGGAASQHVLSASPeqLREIAVQLHAVMDKVALLRHAV 227 Pseudomonas aeruginosa
15077066     181 WGSVGGKVTELLTSAPPelLKEAMSQLHTAMGEVADLQRAV 221 Aeromonas salmonicida
401663       181 WGTIGGAASAYVASGVD--LTQAANEIKGLAQQMQKLLSLM 219 Yersinia pestis
ABJ98887     183 WGTTGRQASEWVSSATQeqLGEVAAGLNDLMHEVAQLRYAV 223 Aeromonas veronii
YP_002176542 162 FGTCSGSARDLVDNASYqqEKIIIKHLNELFEKVALHLVGA 202 Vibrio cholerae AM-19226

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap