1DO2,1IN4,1IQP,1IXR,1JBK,1KSF,1LV7,1NY5,1OJL,1QVR,1QVR,1SXJ,1SXJ,1SXJ,1SXJ,1UM8,1XWI,2C9C,2CE7,2CHQ,2DHR,2HCB,2P65,2QZ4,2RKO,2Z4R,3B9P,3CF0,3CF1


Conserved Protein Domain Family
AAA

?
cd00009: AAA 
Click on image for an interactive view with Cn3D
The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC, RecA-like, VirD4-like, PilT-like, and SF1/2 helicases. Members of the AAA+ ATPases function as molecular chaperons, ATPase subunits of proteases, helicases, or nucleic-acid stimulated ATPases. The AAA+ proteins contain several distinct features in addition to the conserved alpha-beta-alpha core domain structure and the Walker A and B motifs of the P-loop NTPases.
Statistics
?
PSSM-Id: 99707
View PSSM: cd00009
Aligned: 133 rows
Threshold Bit Score: 44.8295
Threshold Setting Gi: 2498713
Created: 1-Nov-2000
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 10 residues -Click on image for an interactive view with Cn3D
Feature 1:ATP binding site [chemical binding site]
Evidence:
  • Structure:2C9C_A; Escherichia coli transcription activator PspF binds ATP and Mg2+, contacts calculated at 3.5 A
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                              ########                                
1DO2_A      17 IGQDNAKRSVAIAlrnrwrrmqlneelrhevtpkNILMIGPTGVGKTEIARRLakla--------------napFIKVEA 82   Escherichia coli
2C9C_A      13 NSFLEVLEQVSHLapl----------------dkPVLIIGERGTGKELIASRLhylss-----------rwqgpFISLNC 65   Escherichia coli
116144      60 HLVIGRAREKLGLtsga--------------ptlHMAFTGNPGTGKTTVALKMaqilhrl-------gyvrrghLVSVTR 118  Xanthobacter flavus
130538     459 GVITSCNKRKAIArkrq--------------vpvCYILTGPPGCGKTTAAQALakklsd---------qepsviNLDVDH 515  Feline calicivir...
130542     497 DLHTMVLGKINMTkqrp--------------qpvAVIFKGAPGIGKTYLVHRIardlgc---------qhpstiNFGLDH 553  Rabbit hemorrhag...
135966     109 YERVQTGELETFRfeear------------staqSLLLIGCSGSGKTTSLHRIlatypqviy----hrelnveqVVYLKI 172  Escherichia coli
1351772    105 IGRAIFGTISSVRdlle--------------sqqSILLLGKPGVGKTTIIREIarvlsd----------emekrVVIVDT 160  Odontella sinensis
2494203   2855 FDQMLDHVLRIDRiyrq--------------sqgHLLLIGTAGAGKTTLSRFVawln--------------glsVFQLKV 2906 Caenorhabditis e...
2494205   2809 FDDVLDHILRIDRvlkq--------------plgHLLLVGSSGVGKTTLTRFVswin--------------nltVFQIKA 2860 Paramecium tetra...
2828193     28 AVVGQDRAIRLLTiaif--------------argHVMLEGDVGVGKTTLLRAVarglggayervegtvdmmptdLIYHTY 93   Methylobacterium...
Feature 1                                                                                      
1DO2_A      83 tkftevgyvgkevdsiirdltdaavkmvrvqaieknryraeelaeerildvlippaknnwgqteqqqepsaarqafrkkl 162  Escherichia coli
2C9C_A      66 aalnenlldselfgheaga------------------------------------------------------------- 84   Escherichia coli
116144     119 ddlvgqyightap------------------------------------------------------------------- 131  Xanthobacter flavus
130538     516 hdtytgnevciidefdss-------------------------------------------------------------- 533  Feline calicivir...
130542     554 fdsytgeevaiadefntcg------------------------------------------------------------- 572  Rabbit hemorrhag...
135966     173 dcshngslkeiclnffraldralgsnye---------------------------------------------------- 200  Escherichia coli
1351772    161 sneiagdsdiphsaigrarrmq---------------------------------------------------------- 182  Odontella sinensis
2494203   2907 hskytaadfdedmrtvlrragcrneklcfimdesnmldt----------------------------------------- 2945 Caenorhabditis e...
2494205   2861 grdyqladfdndlr------------------------------------------------------------------ 2874 Paramecium tetra...
2828193     94 lgedgrprvep--------------------------------------------------------------------- 104  Methylobacterium...
Feature 1                                                                                      
1DO2_A     163 regqlddkeieidlaaapmgveimappgmeemtsqlqsmfqnlggqkqkarklkikdamkllieeeaaklvnpeelkqda 242  Escherichia coli
2C9C_A      85 ----------------------------------------------------------------------ftgaqkrhpg 94   Escherichia coli
116144     132 ----------------------------------------------------------------------------ktke 135  Xanthobacter flavus
130538     534 ----------------------------------------------------------------------dkvdyanfvi 543  Feline calicivir...
130542     573 ----------------------------------------------------------------------dgeswvelfi 582  Rabbit hemorrhag...
135966     201 -------------------------------------------------------------rryglkrhgietmlalmsq 219  Escherichia coli
1351772    183 -------------------------------------------------------------------vattdlqhqimie 195  Odontella sinensis
2494203   2946 --------------------------------------------------gflerlntllangevpglfegdehttlmtq 2975 Caenorhabditis e...
2494205   2875 ---------------------------------------------------------------------------evmkr 2879 Paramecium tetra...
2828193    105 -----------------------------------------------------------------------------gpv 107  Methylobacterium...
Feature 1                  #                                                              #    
1DO2_A     243 idaveqhgIVFIDEidkickrgessgpdvsregvQRDLLPLVEgctvstkh----------gmvktdhiLFIASGAfqia 312  Escherichia coli
2C9C_A      95 rferadggTLFLDElata------------pmmvQEKLLRVIEygelervgg---------sqplqvnvRLVCATNadlp 153  Escherichia coli
116144     136 ilkkamggVLFIDEayyl------------yrpeNERDYGQEAieillqvm-----------enqrddlVVILAGYkdrm 192  Xanthobacter flavus
130538     544 gmvnsapmVLNCDMl------------------eNKGKLFTSKyiimtsnsetpvkpsskragafyrrvTIIDVTNpfve 605  Feline calicivir...
130542     583 qmvntnpcPLNCDKa------------------eNKNKVFNSKyllcttnsnmilnathpragafyrrvMIVEARNkave 644  Rabbit hemorrhag...
135966     220 ianahalgLLVIDEiqhl------------srsrSGGSQEMLNffvtmv---------------niigvPVMLIGTpkar 272  Escherichia coli
1351772    196 avenhmpqVIVIDEigt---------------elEALAARTIAek----------------------gvQLVGTTHgnc- 237  Odontella sinensis
2494203   2976 ikegaqrqGLILDShdel------------ykwfTQQVMRNLHvvftmnpsgsgl---rerastspalfNRCVLNWfgdw 3040 Caenorhabditis e...
2494205   2880 agakgekiTFIFDEsnvl------------gpsfLEKMNALLAsgeipgl-------------fendeyLALINLLkens 2934 Paramecium tetra...
2828193    108 lrraedlsVFFFNEinra------------rpqvHALLLRIMAersvsafn----------reyrfpnlQVFADRNrver 165  Methylobacterium...
Feature 1                                             
1DO2_A     313 k----------------psdliPELqGRLp--IRVELQA 333  Escherichia coli
2C9C_A     154 amv-------------negtfrADLlDRLa-fDVVQLPP 178  Escherichia coli
116144     193 d-----------------rffeSNPgFRSriaHHIDFPD 214  Xanthobacter flavus
130538     606 shkr----------arpgtsvpRSCyKKNf--SHLSLAK 632  Feline calicivirus (STRAIN F9)
130542     645 swqa----------trhgskpgKSCySKDm--SHLTFQV 671  Rabbit hemorrhagic disease virus
135966     273 ei--------------feadlrSARrGAGf--GAIFWDP 295  Escherichia coli
1351772    238 -------------------lenLIKnPPLs--DLIGGIQ 255  Odontella sinensis
2494203   3041 senalyqvgseltrtmdldrtdYEGsVRLtpsCELVPSQ 3079 Caenorhabditis elegans
2494205   2935 nqnkq--------fdsseeqlfKNFtYQVqrnLHVVFTM 2965 Paramecium tetraurelia
2828193    166 e-----------------etfeLPAaARDrflMEIGMEA 187  Methylobacterium extorquens

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap