Conserved Protein Domain Family
Cxxx_AC3_0185
?
TIGR04118: Cxxx_AC3_0185 
modification target Cys-rich peptide, AC3_0185 family
Radical SAM enzyme family TIGR04115 is paired with a number of short peptides with multiple tandem repeats of Cys-Xaa-Xaa-Xaa (see TIGR04114). This family represent a peptide family with a TIGR04114-like region, although the repeat region is relatively short in this group.
Links
?
Statistics
?
PSSM-Id: 200369
Aligned: 3 rows
Threshold Bit Score: 42.9992
Created: 9-Oct-2014
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
Download Cn3D
PubMed ReferencesClick to see Conserved Features Help
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection: 
ZP_05496042  1 MERLFSnKKIGKSRQDISGYACSACDYTCMYGCVDRCTAaCGGGCS 46  Clostridium papyrosolvens DSM 2782
ZP_02632412  1 MKHLFS-KNSSKVNKDVQGYMCLDCSGCCINGCANLCTS-CSNFCS 44  Clostridium perfringens E str. JGS1987
ZP_05494135  1 MKYLFSaKKIKNAQKDVKAYCYSGCTATCALNCATGCRThCGSGCS 46  Clostridium papyrosolvens DSM 2782
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap