Conserved Protein Domain Family
methanobac_OB3b

?
TIGR04071: methanobac_OB3b 
methanobactin precursor, Mb-OB3b family
Methanobactins are siderophore-like copper-chelating natural products with considerable variety from species to species. The 11-residue methanobactin of Methylosinus trichosporium OB3b is derived from a 30-residue precursor. A very similar 31-residue precursor is found in the rice endophyte Azospirillum sp. B510, which has not yet been shown to produce a methanobactin. This model models the shared region of the first 25 amino acids, including a Cys-Gly-Ser motif.
Statistics
?
PSSM-Id: 274960
Aligned: 4 rows
Threshold Bit Score: 38.7203
Created: 9-Oct-2014
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_014890870 250 MTIRIAKRITLNVIGRAGAMCASTCAATNG 279 Methylocystis sp. SC2
WP_018406134 256 MTIRIAKRITLNVIGRASARCASTCAATNG 285 Methylocystis rosea
WP_026598326 235 MAINIVKRTTLVVNGRTGADCGTACWG--- 261 Methylocystis sp. LW5
E3YBA4         1 MTVKIAQKKVLPVIGRAAALCGSCYPCSCM 30  Methylosinus trichosporium
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap