Conserved Protein Domain Family
SusC_RagA_signa

?
TIGR04057: SusC_RagA_signa 
TonB-dependent outer membrane receptor, SusC/RagA subfamily, signature region
This model describes a 31-residue signature region of the SusC/RagA family of outer membrane proteins from the Bacteriodetes. While many TonB-dependent outer membrane receptors are associated with siderophore import, this family seems to include generalized nutrient receptors that may convey fairly large oligomers of protein or carbohydrate. This family occurs in high copy numbers in the most abundant species of the human gut microbiome.
Statistics
?
PSSM-Id: 274949
Aligned: 50 rows
Threshold Bit Score: 34.8633
Created: 10-Oct-2014
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EXY31132      136 DIESMQILKDASSASIYGSRAANGVILITTK 166  Bacteroides fragilis str. 3397 T10
WP_011967160  311 DIESISVLKDAAAIAPYGLGGANGVVLITTK 341  Parabacteroides distasonis
KEJ83521      268 IVQSIDILKDATSSSIYGARGANGVVVITTK 298  Porphyromonas sp. 31_2
WP_005874718  199 DFESMSVLKDASATSIYGARAANGVVFIQTK 229  Porphyromonas gingivalis
WP_011108996  176 DIESISFLKDATAS-IYGMNSANGAVIVTTK 205  Bacteroides thetaiotaomicron
WP_022470364  283 MIEDITILKDAAAVAPYGMAGANGVVLVTTK 313  Bacteroides thetaiotaomicron CAG:40
WP_004319586  248 DIESINFLKDASAA-IYGSKAAGGVVLITTK 277  Bacteroides ovatus
WP_009001271  203 DVERVDVLKDASATAIYGSRGANGVVMITSK 233  Bacteroides sp. D2
WP_005658157  203 DIESIEVLKDASSSAIYGARAANGVVLITTK 233  Bacteroides stercoris
EXY29712      109 DIESLDFLKDASATAIYGARGANGVVMITTK 139  Bacteroides fragilis str. 3397 T10
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap