2W0M


Conserved Protein Domain Family
KaiC_arch_4

?
TIGR03881: KaiC_arch_4 
Click on image for an interactive view with Cn3D
KaiC domain protein, PAE1156 family
Members of this protein family are archaeal single-domain KaiC_related proteins, homologous to the Cyanobacterial circadian clock cycle protein KaiC, an autokinase/autophosphorylase that has two copies of the domain.
Statistics
?
PSSM-Id: 163593
View PSSM: TIGR03881
Aligned: 8 rows
Threshold Bit Score: 368.3
Threshold Setting Gi: 500230153
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2W0M_A         4 RLSTGILDFDKLIQGGIPQGFFIALTGEPGTGKTIFSLHFIAKGLRDGDPCIYVTTEESRDSIIRQAKQFNWDFEEYI-- 81  Sulfolobus solf...
WP_011822025  10 RLPTGVPGFDKLIQGGIPRGFFVAVVGEPGTGKTIFSIHFIAEGIRQGDKNIYVTTEETRESIIKQAAMFGFDFEKAI-- 87  Hyperthermus bu...
WP_011839412   8 RIPTGVKGLDEILRGGIPRGFVVAVVGEPGTGKTVFCIHFIGKGLEMGDKGIYVTTEESRESIIRQAAMFNIDLRKYL-- 85  Staphylothermus...
WP_011998341  23 RLRTGVEGFDDLIAGGIPKGFLVAVVGEPGTGKTVFSIHFAWKGVLDGQKVIYVTTEESRESIISQAAQFGMNFNKAI-- 100 Ignicoccus hosp...
WP_010978557   3 RLSTGIPEFDKLIEGGIPQGFFVAVTGEPGTGKTIFSLHFIAEGLREGDNCIYVTTEESRDSIVRQAKQFNWDFEEYM-- 80  Sulfolobus toko...
WP_011752807   5 RLSTGVAGLDKLLAGGVPEGFFVALVGMPGTGKTIACLHFVWAGLKAGESAIYVTTEESRESIVRQAAQFGMDFEGAQ-- 82  Thermofilum pen...
WP_012187028  29 REAFGIDALDDALEGGLPRGTWTVVTGEPGVGKSILCMHFAYTGLEDDEPVIYVTTETSFRDVVRQARQFNMDLTQFKpv 108 Caldivirga maqu...
WP_011899749   3 RVSTGVEELDRALEGGIPQGSWVVVTGEPGVGKSILCMHFAYAGLRSGDPVVYVTTEQEFRDVMEQARQLGMDFSKFSay 82  Pyrobaculum
2W0M_A        82 ------------E-KKLIIID---------ALMKEKEDQWSL--V-----NLTPEELVNKVIEAKQKLGYG--------K 124 Sulfolobus solf...
WP_011822025  88 ------------DdGKLVIID---------ALMGRHDDPWSL--T-----ELDVETLVNKIIEAKRYLGYG--------R 131 Hyperthermus bu...
WP_011839412  86 ------------DeGNLVIID---------ALMEERGDPWSL--R-----ELDIEELLSKIIEAKKYLGYG--------H 129 Staphylothermus...
WP_011998341 101 ------------EeKKMVIID---------ALLRDKADQWNM--V-----ELTVEELLNKIIEAKKYLGYG--------D 144 Ignicoccus hosp...
WP_010978557  81 ------------E-KKLIIID---------ALMKEKEDEWSL--T-----ELNAEELVNKVIEAKQKLGTG--------R 123 Sulfolobus toko...
WP_011752807  83 ------------KsGRLIIID---------ALMREKEDEWMM--R-----ELAVEEMLSRVIEAKKRLGRS--------A 126 Thermofilum pen...
WP_012187028 109 nlsdvlsgrvkpEnAKLVVIDlfglyrqyrEMVKEAGEEGRRpsR-----ALSIEVLEGAVRKAYEVLGFS--------E 175 Caldivirga maqu...
WP_011899749  83 niaw---rkepeElPEIVVIDifgllkvarQLTEKAKEESPE--KvrryaALSIDTLIEAINEAYDLLAVAkergtperH 157 Pyrobaculum
2W0M_A       125 ------ARLVIDSVSALFLDKPAMARKISYYLKRVLNKWNFTIYATSQYAITTSQAFGFGVEHVADGIIR--FRRMIRNG 196 Sulfolobus solf...
WP_011822025 132 ------ARLVIDSMSAFWLDKPAMARRYSYYVKRILARWDFTALLTSQYAVTTSLGFGFGIEHVADGIIR--FRKAVVRG 203 Hyperthermus bu...
WP_011839412 130 ------ARLVIDSMSAFWLDKPAMARKYSYIVKRRLARWNMTILLTSQYAVTTSLGFGFGVEHVADGIIR--FRKSVLGG 201 Staphylothermus...
WP_011998341 145 ------ARVVIDSMSAFWLDKPAMARKYSYLVKRVLNKWNMTIVATSQYAITTSFGFGFGIEHVADGIIR--FKKMIKGW 216 Ignicoccus hosp...
WP_010978557 124 ------ARLVIDSVSALFLDKPAMARKISYYLKRVLNKWKFTIYATSQYAITTSQAFGFGVEHVADGIIR--FRRAIKDG 195 Sulfolobus toko...
WP_011752807 127 ------RRLVIDSMSAFWLRAPVKAREDSYTVKRILNKWGFTIYATSQYAITTGSAFGWGIEHVADGIIH--FKRRVVDG 198 Thermofilum pen...
WP_012187028 176 gkvsepSRLIIDSMTAFWADKPAMARAYSYALRQSLYRSNITALLVSQYAPTTEASFGFGLEHIADGIIHmwMDKVEQTK 255 Caldivirga maqu...
WP_011899749 158 ------VRLVIDSMSAFWVDKPVMARKYSYQLKIATHRENVTALLTSQYAPTTRQAFGFGLEHIADGVIHmwMDDVESAK 231 Pyrobaculum
2W0M_A       197 ELHRYILIEKMRQTDHDKHVWEIDIVNGKGIVLKG 231 Sulfolobus solfataricus P2
WP_011822025 204 ELRRYVIIEKMRQTEHSLRMHEIEIRDGVGMRVKA 238 Hyperthermus butylicus
WP_011839412 202 ELKRFLVVEKMRQTDHDKRVFLIDIVNEKGLVVLG 236 Staphylothermus marinus
WP_011998341 217 ELKRYVIVEKMRQTPHSLRVHEIEIVDGKGMRVKG 251 Ignicoccus hospitalis
WP_010978557 196 MLHRYVLIEKMRQTNHDKYVWEIDIKPGKGIVLLG 230 Sulfolobus tokodaii
WP_011752807 199 VLTRYIIVEKMRQTPHDLRAWEIQIRDKEGLTLVR 233 Thermofilum pendens
WP_012187028 256 TIRRWLIIKKMRLTNHAKDAYQVDIQPGKGLILIE 290 Caldivirga maquilingensis
WP_011899749 232 EVRRWLIVKKMRMTNHATRAYRVRIEPSRGIVLEP 266 Pyrobaculum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap