Conserved Protein Domain Family
KaiC_arch_3

?
TIGR03880: KaiC_arch_3 
KaiC domain protein, AF_0351 family
This model represents a rather narrowly distributed archaeal protein family in which members have a single copy of the KaiC domain. This stands in contrast to the circadian clock protein KaiC itself, with two copies of the domain. Members are expected to have weak ATPase activity, by homology to the autokinase/autophosphorylase KaiC itself.
Statistics
?
PSSM-Id: 163592
View PSSM: TIGR03880
Aligned: 6 rows
Threshold Bit Score: 332.827
Threshold Setting Gi: 500158483
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_012036880   7 GVQGLDELLQGGFPEKHMIVVVGGMGTGKSTLALQFLVNGLKNGEKSVYMSLEERESEIVESAEGYGWDLQTYIDNnSLI 86  Methanocella ar...
WP_012107932   9 GIPGLDEMLGGGLLAGNICAVIGTYGTGKTTFSLNFIWDGLKRGERAIYISLEEREDRLLQYMKQKGWDVEPYLNK-SLF 87  Methanoregula b...
WP_011448196  14 GIKGLDEMLSGGLIEGTVSSIIGAYGTGKTNFAQYYIWQGLIQGQSALYITLEERTSRILGYMENKGWDVSQYLDS-TFT 92  Methanospirillu...
WP_011224774 166 GIEGLDQMIQGGIPQRHLIVTIGSAGTGKTTFGLQFLHHGLRNGENAVFLTLEQSHDAILDTAGDRGWGFEEYEEQgQLA 245 Haloarcula mari...
WP_010877858   5 GIEGLDAILGGGIPEGHIVAVVGQYGTGKTTLGLHFIYEGLKNGEACMIISFDEDEESIIGDAKSVGMDLTAFGDK--VH 82  Archaeoglobus f...
WP_011833153  14 GIPGLDDMIGGGFIKGSVFVLIGETGTGRTMFSLQYLYQGLLNGEKVMYISLFNPVEQLTGNFLSMYPEMRDRINK-DIY 92  Methanocorpuscu...
WP_012036880  87 LIRLDPNDIKTTLTRIKNEMPRLIKTFGATRLVIDSITLF-EMMFSDEAERRLNLFEIFAILKETGVTALITSEASRADA 165 Methanocella ar...
WP_012107932  88 IIKLDPTDFNLANNRIKNELPNLISEVKASRVVIDPISLF-EDLFSSDAERRREMFRFIDGLREKNCTMMMTSETNSDNV 166 Methanoregula b...
WP_011448196  93 IVNLDPSDFNLAINSVKNELPTLIKKTGAHRVVIDPVSLF-EDLFHDDATRRREMMRFLESLRDLNCTSLLISEADKTNT 171 Methanospirillu...
WP_011224774 246 IVDLDPVEMANSLDNIRGELPALIEKFDADRLVLDSVSLL-EMMYDDQSRRRTEVFDFTRSLKQAGVTTMLVSEASETNP 324 Haloarcula mari...
WP_010877858  83 IVRLEASEVKKSLEKLESDLPEIVRSLGVSRMLVDSISVL-ETLFDDAG-RYSMLAAFRKMLKENGITAIITSEADKYQP 160 Archaeoglobus f...
WP_011833153  93 IVQLPPEIFLTFSSRLGNNVAIMIQELGVSRVVVNPFSVLeETLVTSTGFRSTDLNMVYSSLRSTGATTILHVNSGQTNV 172 Methanocorpuscu...
WP_012036880 166 YSSRYGLVEYVADGVIIL--RYVRPDQLRDVKLAVEVVKMRRHKHSRSIKPYEITDEGIAVHSESEVF 231 Methanocella arvoryzae
WP_012107932 167 FSSRHGLIEYLADTVILL--RYVRSSDLTDVYLALEVVKMRMSSHSREIKPYAIEQTQVTVFSEANVF 232 Methanoregula boonei
WP_011448196 172 FASKYNLIEYLSDTVILL--KYARGEDVNDVHLAIEVVKMRMSQHSREVKPFEIHQDSVTVYTEATVF 237 Methanospirillum hungatei
WP_011224774 325 FASRHGIIEYLTDAVFIL--QYVR-SDTSETRLAVEIQKIRNANHSRETKPYEITNDGISVYQQANIF 389 Haloarcula marismortui
WP_010877858 161 NTSKYGILEYICDGMISL--KVVRKSELDEPTLGLEVVKMRRVKHSRKPKPYIITDSGIVVYEEAEIF 226 Archaeoglobus fulgidus
WP_011833153 173 FASKFGFSEVFADGVACMfrEFPDNDHMRPYRMPFVLLKSRGL-ITKTAKLIKYDESGLFTL-HSPIK 238 Methanocorpusculum labreanum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap