2DR3


Conserved Protein Domain Family
thermo_KaiC_1

?
TIGR03877: thermo_KaiC_1 
Click on image for an interactive view with Cn3D
KaiC domain protein, Ph0284 family
Members of this family contain a single copy of the KaiC domain (pfam06745) that occurs in two copies of the circadian clock protein kinase KaiC itself. Members occur primarily in thermophilic archaea and in Thermotoga.
Statistics
?
PSSM-Id: 163589
View PSSM: TIGR03877
Aligned: 10 rows
Threshold Bit Score: 455.367
Threshold Setting Gi: 499327919
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2DR3_A         3 RRVKTGIPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGL-KMGEPGIYVALEEHPVQVRQNMAQFGWDVKPYE 81  Pyrococcus hori...
WP_011013071   3 RRVKTGIPGMDEILHGGIPERNVVLLSGGPGTGKSIFSQQFLWNGL-QMGEPGIYVALEEHPVQVRQNMAQFGWDVRKYE 81  Pyrococcus furi...
WP_011821602   4 ERVKTGIPGLDEILNGGIPRRNVVLLSGGPGTGKTIMSQQYLWNGL-QMGEPGVYVALEEHPVQVRINMAQFGWDVRPYE 82  Hyperthermus bu...
WP_011943170   3 KKVKTGIPGMDEILHGGIPERNIVLISGGPGTGKTIFSQQFIWNGL-QMGEPGIYVALEEHPVQVKKNMEVFGWNVDPFE 81  Thermotoga
WP_011752461   5 EKVKTGIPGFDELLYGGIPKRNIVLLSGGPGTGKTIFSQQYLFYGL-QNNEPGVLVALEEHPVQIRRNMASFGWDVRKYE 83  Thermofilum pen...
WP_009988518   2 KRVKTYIPGLDEILYGGIPERHIVLVSGGPGTGKSILGKQFLYNGL-TKGEGGVFIALEEHPVSVRRSFEHFKWDVRKYE 80  Sulfolobus solf...
WP_011153170   4 QRVKTGIPGMDELLNGGIPKRNVVLLAGGPGTGKSIMSQQYIYYGL-QNGEPGIYVTLEEHPVAVRENMKNFGWDPTPYE 82  Nanoarchaeum eq...
WP_011018411   4 ERVSTGIPGMDEVLNGGIPERNAVLLTGGPGTGKTIFSQQFIWAGL-EEGEPGVFVTLEEHPVQVRKNVEGFGWNFREYE 82  Methanopyrus ka...
WP_010979897   4 LRVRTYIPGFDEILYGGIPERNIVLISGGPGTGKSILGKQFLYNGLvKKDEPGIFVALEEHPVSVIRSFKHFGWDITKYE 83  Sulfolobus toko...
WP_010870876   2 KRVKTGIPGMDEILHGGIPERNVVLLSGGPGTGKSIFCQQFLYKGVvDYNEPSILVALEEHPVQIRENMRQFGWDIRKLE 81  Methanocaldococ...
2DR3_A        82 EKGMFAMVDAFTAGIGKSKEYEKYIVHDLTDIREFIEVLRQAIRDINAK------RVVVDSVTTLYINKPAMARSIILQL 155 Pyrococcus hori...
WP_011013071  82 EEGLFAMVDAFTAGVGKSKEYEKYIVHDLTDIREFIEVLRQAIRDINAK------RVVVDSVTTLYINKPAMARSIILQL 155 Pyrococcus furi...
WP_011821602  83 REGTFAIVDAFTGGIGETAKRERYVVRDPTDVGLLIDVLKEAIRDTGAQ------RVVIDSVSTLYLTKPSVARSVVMML 156 Hyperthermus bu...
WP_011943170  82 KEGKFAIVDAFTGGIGEYAEKEKYVVKDIDDVRELAEVLKRAVKETQAK------RVVIDSVTTLYITKPAMARSIIFQL 155 Thermotoga
WP_011752461  84 ESGQFAIVDAFTGGIGEAAKRERYVVTSVDDVGELVDVVKAAIRDVKAE------RAVIDSVSTLYMTKPAMARSILMQL 157 Thermofilum pen...
WP_009988518  81 REGKFAIIDTFTGGIGNVAQREKYVVKSIDDVKELSENIRAAIKDINAT------RIVVDSVSTLYLTKPAMARSIVMQL 154 Sulfolobus solf...
WP_011153170  83 EKGMFAMIDGFTGGIGRAAERERFVVPDPTDVRSLIDVVKEAISWIEENtgkppvRGVIDSVTTLYLTKPSVARNIVMML 162 Nanoarchaeum eq...
WP_011018411  83 EEGLLAVVDAFTGGIGRASEYEKYVVKDPTDASELIGVIRQAVNDVEAK------RVAIDSVTPLYIDKPSVARRIMFRL 156 Methanopyrus ka...
WP_010979897  84 KEGKFAIVDAFTAGIGSTAQKEKYVVKDVDNVGELSGVLRDAIRNLNAK------RVVIDSVSTLYLSKPAMARSIVMQL 157 Sulfolobus toko...
WP_010870876  82 EEGKFAIIDAFTYGIGSAAKREKYVVNDPNDERELIDVLKTAINDIGAK------RIGIDSVTTLYINKPMLARRTVFLL 155 Methanocaldococ...
2DR3_A       156 KRVLAGTGCTSIFVSQVSVGERGFGGPGVEHGVDGIIRLDLDEIDGELKRSLIVWKMRGTSHSMRRHPFDITDKGIIVYP 235 Pyrococcus hori...
WP_011013071 156 KRVLAGTGCTSIFVSQISVGERGFGGPGVEHGVDGIIRLDLDEIDGELKRSLIVWKMRGTSHSMKRHPFDITDKGIIVYP 235 Pyrococcus furi...
WP_011821602 157 KRVLSGLGTTSFLVSQVSVTERGFGGPGVEHAADGIIRLDLDEIDGELKRSLIIWKMRGTKHSMRRHPFEITDKGIIIYA 236 Hyperthermus bu...
WP_011943170 156 KRILSGLGCTSLFVSQVSVTEKGFGGPGVEHGVDGIIRLDLDEIDGELKRSLIVWKMRGTSHSMRRHPFEITDKGIVIHP 235 Thermotoga
WP_011752461 158 KRVLSGLGATSIFVSQVSVTERGFGGPGVEHAADGIVRLDLDEVNGELVRSLIVWKMRGTKHDMKRRPFEITDKGIVVYP 237 Thermofilum pen...
WP_009988518 155 KRVISGLGCTAIFVSQVSVGERGFGGPGVEHAVDGIIRLDLDEVEGVMYRSIIIWKMRDTKISMVRHPMDITDNGIIVQW 234 Sulfolobus solf...
WP_011153170 163 KKVFSGFGITAFFVSQVSVAERGFGGPGVEHAADGIIRLDLDEIDGELVRSLIIWKMRGTKHDMRRHPFEITDKGVIVYP 242 Nanoarchaeum eq...
WP_011018411 157 KRMLAGLGCTSILVNQIAAHERGFGGPGVEHAVDGIIRLDLDEVEGRLWRSLIVWKMRGTAHSMRRHPFEITDEGIRVDP 236 Methanopyrus ka...
WP_010979897 158 KRVIAGLGCTAMFISQVSAGERGFGGPGVEHAVDGIVRLDLDEYEGQLYRSVIVWKMRDSKISMVRHPMDITDEGIVIQW 237 Sulfolobus toko...
WP_010870876 156 KRVISGLGCTAIFTSQISVGERGFGGPGVEHAVDGIIRLDLDEIDGELKRSLIVWKMRGTSHSLKRHPFDITNEGIIVYP 235 Methanocaldococ...
2DR3_A       236 DKVL 239 Pyrococcus horikoshii OT3
WP_011013071 236 DKVL 239 Pyrococcus furiosus
WP_011821602 237 NKVL 240 Hyperthermus butylicus
WP_011943170 236 SEGG 239 Thermotoga
WP_011752461 238 DKVI 241 Thermofilum pendens
WP_009988518 235 DKYL 238 Sulfolobus solfataricus
WP_011153170 243 DKVV 246 Nanoarchaeum equitans
WP_011018411 237 EKVF 240 Methanopyrus kandleri
WP_010979897 238 DKYL 241 Sulfolobus tokodaii
WP_010870876 236 DKVL 239 Methanocaldococcus jannaschii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap