Conserved Protein Domain Family
RNA_lig_partner

?
TIGR03875: RNA_lig_partner 
RNA ligase partner, MJ_0950 family
This uncharacterized protein family is found almost perfectly in the same set of genomes as the Pab1020 family described by model TIGR01209. These pairs are found mostly in Archaea, but also in a few bacteria (e.g. Alkalilimnicola ehrlichei MLHE-1, Aquifex aeolicus). While the partner protein has been described as homodimeric ligase that has RNA circularization activity, the function of this protein (also called UPF0278) is unknown.
Statistics
?
PSSM-Id: 163587
View PSSM: TIGR03875
Aligned: 16 rows
Threshold Bit Score: 222.568
Threshold Setting Gi: 499168176
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011696121   5 RFVFDTTALTDSQAWESEGCTTLCEGMSAILHRVAQARLHLGISCYVPyPSVYNEIRDFVRNNNCDIAILGKIDTWLVKK 84  Methanosaeta th...
WP_011499715   4 RFVLDTTALTDLQTREMLEIEDLCQGMRAILDLIAESRLHLQISCYVPfPSVYKELHEFAKNNGCDDEIIAMIDTWLVKK 83  Methanococcoide...
WP_010879429   4 RFVLDTTAITDAGLRIKEGYESLCESAAEVLDLIALARLKLDISCYIPyPSVYTELTSFLKRYGCDEEIFTKLDTWLVKK 83  Archaeoglobus f...
WP_004958916   9 RFVLDTSLFLTPEIRS--GDEDLEAACLDLLDLISEAKLVHNISCYMP-PSIQAELTTMLEDRAISDEVLTKLDTWVITK 85  Haloarcula
WP_011822687  12 VYVLDTSALTDTRLRSLLGSGSLDEAVRRFAELIASVRIAYGVEVYMP-PTVYEEARRFLLSNGVTVQSFEALAAWITIK 90  Hyperthermus bu...
WP_010880535   3 VFVLDTSVFTNPEIYRTFEEDQR-GAMETFIHLALNSR----AEFYMP-TSVYTEMRKIMDVGELWAE----FEMVVKIR 72  Aquifex aeolicus
WP_011815029   3 RFVLDTSVFTNPDVYLRFDEEPM-QAISVFLGLARRA----DAEFYMP-GPVYQELCNLRSMDLIGAE----FETEVYIR 72  Halorhodospira ...
WP_011630289   3 RFVLDTSVFTNPHCAVQFGEDPL-AGVQTFLHLARRC----PAEFYMP-LSVYDEFRRMRDLAEMAAD----FETDVWVR 72  Alkalilimnicola...
WP_011250376   2 KFVLDTSIFVNPEVRKNFGDNP-TEAMKTFLSYA--EKLFGKVEFYMP-PGIYREVMHFVDSEELRPA----IELYIIKK 73  Thermococcus ko...
WP_002809561   3 RFILDTSVFTNPDTFNQFARDAV-EATRIFLQLARRA----DAEFFIP-GSVYEEFRLMKDLASLGGD----FESVVKIR 72  Nitrosococcus o...
WP_011696121  85 TPDRYRVKIPSKIFYEYVDYMRSRINKGMNVSEEAIWEAVSRCLSISATGEG----REQmreeierevV---------GS 151 Methanosaeta th...
WP_011499715  84 TPDRHEVKIPSHIFHEYVSYMRERINKGMTVAEEAIREASIQCLSIESEIED----TRK---------VedntdreviGP 150 Methanococcoide...
WP_010879429  84 TPNRYEVKIPAAIFYEYIITVRQKMNRGRRLAEEYILESSAITAKLEDKSKI----EEE---------I---------GA 141 Archaeoglobus f...
WP_004958916  86 SPAHHEVRIPADLVYEFIDEMSERVDRGLRVSEKAVRKAEESRAETVEEHDH----MTE---------V---------DK 143 Haloarcula
WP_011822687  91 PPTRHEIRIPASIVRDYVEEVRARLARGLRVAEEHVRRAFEAGGLYAAETASrearREK---------L---------GA 152 Hyperthermus bu...
WP_010880535  73 SPRRFQLTVPADFLYEFIEELRYRINKGLRIAEEHTREASGCED------------------------V---------GK 119 Aquifex aeolicus
WP_011815029  73 SPRRFSMTIPSEVLYEFIEEVRTRIQRGLRIAEEHARQAGQAESL-----------------------P---------PE 120 Halorhodospira ...
WP_011630289  73 SPRRFSMTIPAEILYEFIHELRGRIDRGLRIAEEHTRQAGAATDM-----------------------R---------PE 120 Alkalilimnicola...
WP_011250376  74 PPNVHELKIPAFVVYELIEDIRRRIDKGLRVAEKAVRESVLDTDN-----------------------V---------DN 121 Thermococcus ko...
WP_002809561  73 SPRRYSLTIPSEFLYELIHEVRHRIDRGLRIAEEHARMAAQPGTVAD---------------------Q---------GA 122 Nitrosococcus o...
WP_011696121 152 IIRKFREKYRAALRYGILDSAPDIDVLLLAKDLDAAVVSQDLGIQRWAEQLGLRFMEARAFPQMVREYM 220 Methanosaeta thermophila
WP_011499715 151 IVGKFRNKYRSALRYGILDSAPDIDVLLLAKELDAAVVASDYGIQKWAEQLGVRFVPANTFPMMLKEYL 219 Methanococcoides burtonii
WP_010879429 142 LISKFRDKYRAVMRQGILDSAPDLDVLLLAKELEAGVVSSDAGIRKWSERLGLRFVEAAKFPRMLKEYL 210 Archaeoglobus fulgidus
WP_004958916 144 VISDLRDEYRDTLRQGVLDSREDFDLLILAQELDAGVVTEDQGIINWAEDFGLRYLKGRNFPPLLREYL 212 Haloarcula
WP_011822687 153 IIRGLRERYREATRHGMLDSVEDLDAVLLALEVRGVLVSNDEGVRRFAEALGVISIDPPKFISVLQGLL 221 Hyperthermus butylicus
WP_010880535 120 LIARLREKYREALRQGILDSKEDVDVLLLAYELDGVLVSADEGLRTWADKIGIKLIDPKNFKNILESLV 188 Aquifex aeolicus
WP_011815029 121 LITQLRERYREAMRRGILDSREDIDVVLLAYELDATLVSADEGMRKFAERIGIKLVNPRYLRGVMQNLa 189 Halorhodospira halophila
WP_011630289 121 LIASLRERYREAMRKGLVDSREDVDAVLLAMELDAELVSADEGMRKLGNRMGVKLLTADYLRQVMENLg 189 Alkalilimnicola ehrlichii
WP_011250376 122 IIQKLRRNYRRALREGIVDSKEDFELILLAMELDATIVSADVGILTWAQKMGIKWVDSSVFREVLEGLV 190 Thermococcus kodakarensis
WP_002809561 123 LITRLRERYRETLRRGIVDSREDIDVLLLAYELDGVLLSADEGLRKWADKVGVKIILPQHLRRVLENLT 191 Nitrosococcus oceani
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap