Conserved Protein Domain Family
4cys_cytochr

?
TIGR03874: 4cys_cytochr 
c-type cytochrome, methanol metabolism-related
This family represents a c-type cytochrome related to (but excluding) cytochrome c-555 of Methylococcus capsulatus. Members contain four invariant Cys residues, including two from a heme-binding motif shared with c-555, and two others.
Statistics
?
PSSM-Id: 163586
View PSSM: TIGR03874
Aligned: 7 rows
Threshold Bit Score: 249.727
Threshold Setting Gi: 501210353
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_012253371  62 AATAAKEEDGKYFDKDGHPTFHITNDGKkVDWFTYSGYRRYHAECHVCHGPDGMGSTYAPALKDSLKRLSYEEFYGILAG 141 Methylobacteriu...
KGJ66678      28 PTAVKKEDDGKWLDKEGNPTYKISADGT-VDWFTYSGYRRYHSDCHVCHGPDGMGSTYAPALKDSVKTMSYGDFLGVVAS 106 Bradyrhizobium ...
WP_012029074  14 DASAVKSEDGKYFDKEGNPTYKVAADGT-VDWYTYSGYRRYHSECHVCHGPDGMGSTYAPALKDSVKNMSYGDFLGVVAS 92  Bradyrhizobium ...
WP_011662299  44 PTSVSKSIDGKYLDKEGTPTFHIAADGT-VDWFTYSGFRHYHSECHVCHGPYGEGSSYAPALKDSVKQMSYGEFLNVVAT 122 Rhodopseudomona...
WP_026168921  31 NITAVRDENGRYYTADDVPTFKIAEDGT-VDWLTYSGFRRYHSECHVCHGPEGEGSSYAPALKTSAINMDYYDFVDVVTN 109 Sinorhizobium m...
WP_002719728  33 DVAVASSDGIRSFNAEDVPTFDIAEDGT-VDWPTFSGYRRYQSECHVCHGPDGMGSSYAPALKDSVMRIDYYTFLETIAN 111 Rhodobacter
WP_011567181  30 LYEAAYSEDGRYFNADDIPTYNITEDGT-VDWLTFSGFRRYHAECHVCHGPDGEGSTYAPAVKNAAVTLGYEGFFDVVVN 108 Roseobacter den...
WP_012253371 142 GKQEISNTANQVMPAFGDNKNVMCYANDLYVYLRARAAGAWGRARPGEKEDKPESAKTVEKECL 205 Methylobacterium extorquens
KGJ66678     107 GRKNISTAQENVMPAFGDNPNVACYMDDLYVYLRARSNEAWGRQRPSKKEEKNETYTKAEDACM 170 Bradyrhizobium diazoefficiens S...
WP_012029074  93 GRKNVSTAQENVMPAFGDNPNVACYMDDLYIYLRARSNDAVGRVRPAKHEDKPPAYTEAENSCM 156 Bradyrhizobium sp. ORS 278
WP_011662299 123 GRQNVSSSSENVMPAFGHNLNVACHLDDLYIYLRARAEDALGRVRPAKREDKPEVAKQEEASCM 186 Rhodopseudomonas palustris
WP_026168921 110 GRKKVNAAENSVMPAFGENVNVMCYLDDIYVYLKARGADALPRGRPAKKEAKSDAIKEAETACL 173 Sinorhizobium meliloti
WP_002719728 112 GKQEVGAAKTLVMPAFGTNANVMCYVDDIWTYLRARGTGALDRGRPAKRADKSPEYAEVEKTCM 175 Rhodobacter
WP_011567181 109 GRQN----GNSVMPHFGENRNVMCYLDDIYVYLKARGTDALPRGRPAKKEAKSDAIREDENACM 168 Roseobacter denitrificans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap