Conserved Protein Domain Family
F420-0_ABC_ATP

?
TIGR03873: F420-0_ABC_ATP 
proposed F420-0 ABC transporter, ATP-binding protein
This small clade of ABC-type transporter ATP-binding protein components is found as a three gene cassette along with a periplasmic substrate-binding protein (TIGR03868) and a permease (TIGR03869). The organisms containing this cassette are all Actinobacteria and all contain numerous genes requiring the coenzyme F420. This model was defined based on five such organisms, four of which are lacking all F420 biosynthetic capability save the final side-chain polyglutamate attachment step (via the gene cofE: TIGR01916). In Jonesia denitrificans DSM 20603 and marine actinobacterium PHSC20C1 this cassette is in an apparent operon with the cofE gene and, in PHSC20C1, also with a F420-dependent glucose-6-phosphate dehydrogenase (TIGR03554). Based on these observations we propose that this ATP-binding protein is a component of an F420-0 (that is, F420 lacking only the polyglutamate tail) transporter.
Statistics
?
PSSM-Id: 163585
View PSSM: TIGR03873
Aligned: 5 rows
Threshold Bit Score: 351.809
Threshold Setting Gi: 229566978
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EEJ12727        6 QLRLSHVSWHAGSVPILTDVTVDFPHGKVTGLLGPNGSGKSTLLRLLSGAIRPTQGHV---TLDGVD------VHAWSAR 76  Jonesia denitr...
EEW83929       91 GLRASRMTWSVDGRTIVDGVDCTAPAGALTGLVGPNGSGKSTLLRLLTGVLGADRGEV---DFAGSD------LLGLRRR 161 Sanguibacter k...
EAR25996       23 GLEASRLSVSRGGRLLVDDVDISAPPGSLSAVLGPNGAGKSTLLSLIAGLEQPDAGTV---SLGGGN------LTGLSRR 93  marine actinob...
EEN36564        2 ELTIAGAGTRLGGRWVVDGVDATPPAGALTGLLGPNGAGKTTLLRLVAGLLAPEAGAVlvsDPAAADpaptlpVHTMPRR 81  Cellulomonas f...
jgi:Bcav_2584  17 DLRLERVSWRAGRRLIVDGVDVTAPPGSVTGVLGPNGSGKSTLLRLVVGALPPAEGTL---LLAGED------LRTMTRR 87  Beutenbergia c...
EEJ12727       77 RRACLMATIDQHNDTGAPVTVRDAVALGRIPHRSLFAGETPHDAAVTDHYITMMELTSFASRDMTTLSGGESQRTHVARA 156 Jonesia denitr...
EEW83929      162 ERARQLAVVEQDASAELPLTVRDAVLLGRIPHRSLLAGDSAADHAIADEALARTGMSHFADRTLSTLSGGERQRVHMARA 241 Sanguibacter k...
EAR25996       94 ARALRVALAEQEVRDAPNLSVREVVALGRTPHLGAWGLSSDEDDEVVARCLADTELSALATRSYDTLSGGERQRVNLARA 173 marine actinob...
EEN36564       82 VRARHVALLEQSSDAAVPLSVREVVALGRIPYRSLWGADP--DAGAVDRALGAASAEHLADRAWSTLSGGERQRVHVARA 159 Cellulomonas f...
jgi:Bcav_2584  88 ARARRIALVEQDSPTDVPLRALDVVLLGRTPFRSRWATDSPDDVELARAMLARVGAADLADRDVPTLSGGERQRVHLARA 167 Beutenbergia c...
EEJ12727      157 FTQQPKILLVDEPTNHLDIRAQFEVLAAVSTQAhrtstpptasgkapevATQTTVVIAMHDLTLAARYCDNLILLDHGRI 236 Jonesia denitr...
EEW83929      242 LAQRPRLLVLDEPTNHLDISAQLETVALLRELA----------------DEGVTVLAALHDLSLAASVCDHVVVLGGGRV 305 Sanguibacter k...
EAR25996      174 LAQEPGLLLLDEPTNHLDVRAQLGTLSLLRQLVagaag------iharvGPRPTVIAALHDLNLAAMFADHVVVLAAGRV 247 marine actinob...
EEN36564      160 LAQEPSLLLLDEPTNHLDVSAQLALLGFVRDL-------------------GVTTVAALHDLNLAAAYCEHVLVLSGGRL 220 Cellulomonas f...
jgi:Bcav_2584 168 LAQEPHLLLLDEPTNHLDVAAQLALLRLVREL------------------DGVTTLVALHDLNHAMSACDHVVVLDGGRV 229 Beutenbergia c...
EEJ12727      237 VATGTPRHVLTPARIRAVYGVDATMFDHPDTGELIIALNPL 277 Jonesia denitrificans DSM 20603
EEW83929      306 VAAGPVGEVLVPEVLDAVYGVRCTVLTHPETGRPVLSFALA 346 Sanguibacter keddieii DSM 10542
EAR25996      248 VASGDPVLVLTRELIASVWGVDASVLTHPVTGRPIIAFTGI 288 marine actinobacterium PHSC20C1
EEN36564      221 AAAGPPADVLTPALVREVYGVDAHVLTHPMTGRPVIAYSPT 261 Cellulomonas flavigena DSM 20109
jgi:Bcav_2584 230 AAAGPPSEVLTPDLLARVYGVRADVV--PHARGVTLVFSEL 268 Beutenbergia cavernae DSM 12333
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap