Conserved Protein Domain Family
F420-0_ABCperm

?
TIGR03869: F420-0_ABCperm 
proposed F420-0 ABC transporter, permease protein
his small clade of ABC-type transporter permease protein components is found as a three gene cassette along with a periplasmic substrate-binding protein (TIGR03868) and an ATPase (TIGR03873). The organisms containing this cassette are all Actinobacteria and all contain numerous genes requiring the coenzyme F420. This model was defined based on five such organisms, four of which are lacking all F420 biosynthetic capability save the final side-chain polyglutamate attachment step (via the gene cofE: TIGR01916). In Jonesia denitrificans DSM 20603 and marine actinobacterium PHSC20C1 this cassette is in an apparent operon with the cofE gene and, in PHSC20C1, also with an F420-dependent glucose-6-phosphate dehydrogenase (TIGR03554). Based on these observations we propose that this permease protein is a component of a F420-0 (that is, F420 lacking only the polyglutamate tail) transporter.
Statistics
?
PSSM-Id: 163581
View PSSM: TIGR03869
Aligned: 5 rows
Threshold Bit Score: 340.679
Threshold Setting Gi: 229566977
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:Bcav_2583  38 ALAVSFVVAVAVGTADISpgqiVGSAWHHAAAALERVLGGAVSVpanpLSTIQDAIIWQGRAPRVVTAAAVGAGLAIAGA 117 Beutenbergia c...
EEW83930       44 VLVATVLVAVTIGSADLG----VGEVWRSVAWHVTRGLGVDGLLsvepLSVLRDGIVWELRLPRVLTAAAVGAGLALCGA 119 Sanguibacter k...
EAR25995       29 AVLSSLVFAVTIGPAPLS----AGDVFASVRAHLGLGESA--------LSAIQDGIVWELRMPRVLTAAAVGAGLALCGA 96  marine actinob...
EEN36563       42 ALVATLLVAVTIGPADVA----VGEVVRSVLAHLGLRPAD--------VPRLHDAIVWDLRLPRVLTAAAVGAGLAVAGA 109 Cellulomonas f...
EEJ12726       43 VVLASIIGGVLVGPAQIS----VAQVLQVFATESGVGEGFPGVA----VSRLEHAMVWDLRLPRVLTAGFVGAGLAISGV 114 Jonesia denitr...
jgi:Bcav_2583 118 VMQALMRNPLADPYLLGISSGATLGAVAVLLLGVAVLLPVAAFGGALLALALTLALAGatTGSRLTPSRTILAGVAVAQG 197 Beutenbergia c...
EEW83930      120 VMQSLTRNPLADPYLLGLSSGASLGAVLVLVLGVSVLLPVAAFAGAVLALAAALGLAG--ALGAITPTRTILSGLAVSQL 197 Sanguibacter k...
EAR25995       97 VMQALTRNPLADPYLLGLSSGASVGAVVVIVLGAAVVLPLAAFAGALAALGATLGLAR--TAGALTPTRTVLAGLAVSSV 174 marine actinob...
EEN36563      110 VMQSLTRNPLADPYLLGLSSGASLGAVAVLVLGVALLLPVAAFAGALLALVATLTLAR--TGGTLTPTRAVLAGLAVSQL 187 Cellulomonas f...
EEJ12726      115 IMQSLTRNPLADPYLVGLSSGASLGAVSVLVLSASVALPVAAFLGSLGALIATLGLAR--ALGTVTPTRVILAGLAVSQL 192 Jonesia denitr...
jgi:Bcav_2583 198 CAAVTSFVIFTSAQGDSYREVLSWLMGSLGGATWLSVAIACGALAVVGTVLVTGGRTLDAFAFGDTSATSLGVGVARTRW 277 Beutenbergia c...
EEW83930      198 CAAATSFVIFWSATGDSYREILSWLMGSVAGATWGSVAIAGIAVLVLGSVLALSGSVLDAFTFGDSSAAALGVSVERTRW 277 Sanguibacter k...
EAR25995      175 FGAVTSLIIFWSATGDSYREILSWLLGSLAGTDWGSVQLAGGALLVVGLPLLASARILDAFAFGDRAAAALGIDVGRSRA 254 marine actinob...
EEN36563      188 AAAATSFVVFWTATGDSYREILSWLMGSLAGATWSSAAIAGTALLVVGTVVLLAAGRLDAFAFGDTAAAALGVDVDRTRW 267 Cellulomonas f...
EEJ12726      193 CSALVSFVVFTAASGDTYREVLAWLLGSLASASWDSAAIGVAVYVVVGLPLLATGNVLDAFTFGESHAHALGVRVEQWRW 272 Jonesia denitr...
jgi:Bcav_2583 278 IGLGLVALLVGALVSVSGSIGFVGLVVPHAVRLAVSSRHVRLLPVSAGVGAIVLLWADTLARTVIAPRELPVGILTAAIG 357 Beutenbergia c...
EEW83930      278 LLLVGVALLTGALVSVSGAVGFVGLILPHAVRLLTGARHRLLLPLAALTGASFLVWADTIARTVFAPREVPVGIITAAIG 357 Sanguibacter k...
EAR25995      255 LLLTGTALLTGALVAVSGSIGFVGLILPHAVRLLVGARHRALLPLSALAGALFLIWADTAARTVFDPRELPVGIITALVG 334 marine actinob...
EEN36563      268 TMMTLVALLTGAMVAVSGAIGFVGLVLPHAVSVVTGPAHRRLLPVAALAGAVLLVWADTLARTVFDPRELPVGIVTALIG 347 Cellulomonas f...
EEJ12726      273 ALLIAVALLVGVLVSISGAIGFIGIIVPHTVRLFTGPRHRLLLPFSAMCGAVFLMWSDTLARIIMEPKEIPVGVITALVG 352 Jonesia denitr...
jgi:Bcav_2583 358 APVFAVLLLRSRRGA 372 Beutenbergia cavernae DSM 12333
EEW83930      358 APVFALLLWRGRRSA 372 Sanguibacter keddieii DSM 10542
EAR25995      335 GPVFAIILMRSRSVQ 349 marine actinobacterium PHSC20C1
EEN36563      348 VPVFAVLLRRGRGGS 362 Cellulomonas flavigena DSM 20109
EEJ12726      353 APIFAWALYRHRSGT 367 Jonesia denitrificans DSM 20603
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap