Conserved Protein Domain Family
phenyl_ABC_PedC

?
TIGR03861: phenyl_ABC_PedC 
alcohol ABC transporter, permease protein
Members of this protein family, part of a larger class of efflux-type ABC transport permease proteins, are found exclusively in genomic contexts with pyrroloquinoline-quinone (PQQ) biosynthesis enzymes and/or PQQ-dependent alcohol dehydrogenases, such as the phenylethanol dehydrogenase PedE of Pseudomonas putida U. Members include PedC, an apparent phenylethanol transport protein whose suggested role is efflux to limit intracellular concentrations of toxic metabolites during phenylethanol catalysis. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids]
Statistics
?
PSSM-Id: 163573
View PSSM: TIGR03861
Aligned: 4 rows
Threshold Bit Score: 376.076
Threshold Setting Gi: 499256046
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EAR62110       7 WHCFKGVLIREFLRFVQQRSRFLSALVRPLLWLVVFAAGFRAALGISIIQPYDTYITYETYIAPGLCCMILLFNGMQSSL 86  Neptuniibacter ...
WP_011047247   5 LIALRAIVLREALRFVRQRGRFVAALVRPLIWLLVFAAGFRAALGLSITPPYQTYITYEVYIVPGLCGMIALFNGMQSSL 84  Ruegeria pomeroyi
WP_011042718   6 LYCFNGIVKREVLRFFQQRSRLLSALVRPLLWLVVFAAGFRAALGVSIMEPYGTYITYQQYITPGLCCMIILFNGMQSSL 85  Colwellia psych...
WP_010953586   5 WQCFNGIMLREWLRFVLQRTRLLSALVRPLLWLLVFAAGFRAALGIAIIEPYDTYIPYEVYIIPGLACMILLFNGMQGSL 84  Pseudomonas put...
EAR62110      87 SMVYDREMGSMRVLLMSPLPRPYLLLCKMIATALISLTQVYAFLFIALMVDVEPPVIGYLSVLPALVLVALLLSSLGLFL 166 Neptuniibacter ...
WP_011047247  85 SLVYDREMGSMRLLLTSPLPRWWLLFCRLLASTAISILQTYCFLAVAAAFGIQLPVWGYVAVLPALVVAGIMLGALGLAL 164 Ruegeria pomeroyi
WP_011042718  86 SMVYDREMGSMKVLLMSPLPRPFLLCCKLIASALLSLLQVVIFLLFARLVDVDIPLMGYVSSIPAIFLIAFFLGALGLML 165 Colwellia psych...
WP_010953586  85 SMVYDREMGSMRVLLTSPLPRPFLLGSKLLATSLISLLQVYAFLAIAWLYGVQPPAAGLLMALPALLLVAFMLSALGLLL 164 Pseudomonas put...
EAR62110     167 STQIKQLENFAGIMNFVIFPMFFLSSALYPLWKMQEASDWLYWICMINPFTHAVELVRFALYTQLNTDALMITAGTTLLF 246 Neptuniibacter ...
WP_011047247 165 SSLIRQLENFAGVMNFVIFPMFFLSTALYPLWKMAESSTLLRDICALNPFTHAVELIRFALYGQFNGPALGWTVLAGTVF 244 Ruegeria pomeroyi
WP_011042718 166 SNLIKQLENFAGVMNFVIFPMFFLSSALYPLWKMQEASLWLYWLCQFNPFTSCVELLRFALYGQMNLAALTTVLIATSIA 245 Colwellia psych...
WP_010953586 165 SNAIRQLENFAGVMNFVIFPLFFLSSALYPLWKMREASQWLYWLCAVNPFTHAVELVRFALYERLNLLALAVCLGLTALF 244 Pseudomonas put...
EAR62110     247 TLLAVTGFRPQKT 259 Neptuniibacter caesariensis
WP_011047247 245 LGLAFWGYDPARG 257 Ruegeria pomeroyi
WP_011042718 246 SFFALMSFKPLHG 258 Colwellia psychrerythraea
WP_010953586 245 TLLAILTFNPQHA 257 Pseudomonas putida group
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap