1J5P,2DC1


Conserved Protein Domain Family
NAD_NadX

?
TIGR03855: NAD_NadX 
Click on image for an interactive view with Cn3D
aspartate dehydrogenase
Members of this protein family are L-aspartate dehydrogenase, as shown for the NADP-dependent enzyme TM_1643 of Thermotoga maritima. Members lack homology to NadB, the aspartate oxidase (EC 1.4.3.16) of most mesophilic bacteria (described by TIGR00551), which this enzyme replaces in the generation of oxaloacetate from aspartate for the NAD biosynthetic pathway. All members of the seed alignment are found adjacent to other genes of NAD biosynthesis, although other uses of L-aspartate dehydrogenase may occur.
Statistics
?
PSSM-Id: 163567
View PSSM: TIGR03855
Aligned: 8 rows
Threshold Bit Score: 295.088
Threshold Setting Gi: 500145849
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1J5P_A        32 NFEKIYAYDRISKD------------IPGVVRLDEFqVPSDVSTVVECASPEAVKEYSLQILKNPVNYIIISTSAFADEV 99  Thermotoga mari...
WP_011449316  22 GFTVEALFDRLPDHaeela---rmcgAPAYADFQEF-ISQDFDICVEAASVLAVREYAPKILENGKHVLILSVGALSDTN 97  Methanospirillu...
WP_012106037  22 GFTIPAVYDTKPERakeia---dlcnGKAYGDFAAF-LEADTDIVVEAASVGAARAHAQEVLEHKKNLVIMSVGALTDQE 97  Methanoregula b...
WP_011821852   8 NAELVALYDVARERceklaselkrfkPRIASCFEEL-LGSKPDVVVEAASQQAVREYGLRVLESGADLIVLSVGALMDRD 86  Hyperthermus bu...
WP_015919240  26 HFEKVYAFDKFRKDh-----------IPDIHWLEEFhVPEDVDTVIECASPEAVKEYSSQILKSPVNYLIISTSAFADRV 94  Thermotoga neap...
WP_010870429  27 NAKISAVYDRNFDKaktls---ertgAKICSSIDDL-VKEDLDLVVEAASIKAVEEIAEKSLINNKDVLIMSVGALADKK 102 Methanocaldococ...
WP_011695438  27 NADLAAVFDRNPKNmnrli---eamrNKPEVVELEE-LAELSDIVVEAASQAAVPQVAEAALKRGKDIMIMSVGALMDRE 102 Methanosaeta th...
2DC1_A        23 GFEIAAILDVRGEh------------EKMVRGIDEF-LQREMDVAVEAASQQAVKDYAEKILKAGIDLIVLSTGAFADRD 89  Archaeoglobus f...
1J5P_A       100 FRERFFSELKNSPARVFFPSGAIGGLDVLSSIK-DFVKNVRIETIKPPKSLG------------L------------DLK 154 Thermotoga mari...
WP_011449316  98 FRKILLDVARSQGKKIHIPSGAIMGLDNLKVGGiSRIDSVLLRTTKSPASLG------------M------------QVS 153 Methanospirillu...
WP_012106037  98 LREGLVAVARQTGTKIYVPSGAIFGLDNVKIGQiSPISKLLLKTTKSPQSLG------------L------------DAP 153 Methanoregula b...
WP_011821852  87 LLAKLVEAARRKRRHIYTPSGAIAGLDAVYALSlNGIRSVRLVTRKPPRALK------------DapyvrekginldETR 154 Hyperthermus bu...
WP_015919240  95 FRESFFEELKVSPAKVFFPSGAIGGLDLLAAVR-KNIHRVIIETRKHPKSLG------------I------------NIE 149 Thermotoga neap...
WP_010870429 103 LFLKLRDLAKTVGRKIYLPSGAIGGLDAIKALRlGEIEEVVLKTTKPVAALE------------Dalknl--gykpeDIK 168 Methanocaldococ...
WP_011695438 103 LYRRICSMAESSGGRVYIPSGAITGLDGLKSASvGRLKRVVLTSTKPPASLEgapyvveknmdlR------------SFR 170 Methanosaeta th...
2DC1_A        90 FLSRVREVCRKTGRRVYIASGAIGGLDAIFSAS-ELIEEIVLTTRKNWRQFG------------R--------------- 141 Archaeoglobus f...
1J5P_A       155 GKTVVFEGSVEEASKLFPRNINVASTIGLIVGFEkVKVTIVADPAMDHNIHIVRISSAIGNYEFKIENIPSPENPKTSML 234 Thermotoga mari...
WP_011449316 154 HRTLAFRGKANECIKQFPKNINVSVALALAVHHD-VDVELWADPEVDRNIHDIFVSGEFGEASIRVVNHPSPDNPATSYL 232 Methanospirillu...
WP_012106037 154 IRRRIFSGKAHECIKLYPKNVNVSVAMGLAAGQD-ADVELWVDPAADKNIHELFIEGDFGETYIRVTNVPSPENPATSYL 232 Methanoregula b...
WP_011821852 155 EPTTIYVGPASEAVKYFPANVNVAAALSLAAKKE-ATVEIVADPTVERNIHEIHVDSEASKLTIRVENTPSPMNPRTSYL 233 Hyperthermus bu...
WP_015919240 150 GETTVFEGSVEEAAKLFPRNINIASTVGLIAGFEkVKVIIKADSSLSNNVHIISVISDVGKYEFRIENLPSPENPKTSMV 229 Thermotoga neap...
WP_010870429 169 NPVIVFEGDVFKAIKEFPANINVSVTLSIAAEFP-AKVVIVADPNAKLNKHELFVKSSIGTLRVCIENVPFEENPRTSAL 247 Methanocaldococ...
WP_011695438 171 EPTLIYEGPASEAVRAFPANVNVAATLSLTYGQD-AWVRIVVDPKATVNVHEVVAEGDFGRMVTRVENVPSPRNPRTSYL 249 Methanosaeta th...
2DC1_A       142 -KGVIFEGSASEAAQKFPKNLNVAATLSIASGKD-VKVRLVAD-EVEENIHEILVRGEFGEMEIRVRNRPMRENPKTSYL 218 Archaeoglobus f...
1J5P_A       235 TVYSILRTLRNLESKIIF 252 Thermotoga maritima
WP_011449316 233 AALSVLSLLKNLDSPLVI 250 Methanospirillum hungatei
WP_012106037 233 AALSILSLLKNLDSPLVI 250 Methanoregula boonei
WP_011821852 234 AALSAIALLKRLADERLW 251 Hyperthermus butylicus
WP_015919240 230 TVYSILKTIESLNSKIVF 247 Thermotoga neapolitana
WP_010870429 248 AAYSAVRLIRDLAEPVKV 265 Methanocaldococcus jannaschii
WP_011695438 250 AALSAIATLRNATLNVRI 267 Methanosaeta thermophila
2DC1_A       219 AALSVTRILRNLKEGLVV 236 Archaeoglobus fulgidus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap