Conserved Protein Domain Family
F420_MSMEG_3544

?
TIGR03854: F420_MSMEG_3544 
probable F420-dependent oxidoreductase, MSMEG_3544 family
Coenzyme F420 has a limited phylogenetic distribution, including methanogenic archaea, Mycobacterium tuberculosis and related species, Colwellia psychrerythraea 34H, Rhodopseudomonas palustris HaA2, and others. Partial phylogenetic profiling identifies protein subfamilies, within the larger family called luciferase-like monooxygenanases (pfam00296), that appear only in F420-positive genomes and are likely to be F420-dependent. This model describes a small family, closely related to other such families in the putative F420-binding region, exemplified by MSMEG_3544 in Mycobacterium smegmatis. [Unknown function, Enzymes of unknown specificity]
Statistics
?
PSSM-Id: 163566
View PSSM: TIGR03854
Aligned: 4 rows
Threshold Bit Score: 415.786
Threshold Setting Gi: 499921267
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_014877740   9 RFGVGLGADTTPEDLPGIVDYLESSGADSVWFSELVYSPAVDPFIGMAYTLSRTTRLKAGTSVAILPGRHPVLVAKQVAS 88  Mycobacterium s...
WP_011894107   4 RFGVGLGAEVAPPELPAVVDRLESTGVDSLWLSELVYSSAVEPFVGMAHALGRTSRLKVGTSVAVLPGRHPVLVAKQLAS 83  Mycobacterium g...
WP_011725079   4 RFGVGLGADNAPAELGAIVDHLESTGVDSLWFSELVYSPAVDPVVGMAFALARTHRLKVGTSVAVLPGRHPVLVAKQLAS 83  Mycobacterium a...
WP_011602001   4 RIGIGFGS-VAPAGFAALVDRLEKLEIDSLWLSEQLSTPAVDPLAGMAFALGRTSRLKVGTGVSVLPGRNPVLLAKQLAS 82  Frankia alni
WP_014877740  89 LAALAPRRVLPAFGLHSALTAERDVFTVPRGR-------------------------RGAVFDESLELLNAVLRGRDvSF 143 Mycobacterium s...
WP_011894107  84 LAALAPKRVLPVFGLRSAMPAEREAFVVPAGR-------------------------RGAVFDESLRLLRASLEGPT-TF 137 Mycobacterium g...
WP_011725079  84 LAAVAPKRVLPVFGLRSAIPAEREVFVVPDGE-------------------------RAAVFDESLRLLRAALVEDSaTF 138 Mycobacterium a...
WP_011602001  83 LALLAPRRVLPVLGLAPGRPGDRPAYPLPPGRtearaaptaghgesraagtpgtvgrRGEVFDEALEVLRRLLREPRvTF 162 Frankia alni
WP_014877740 144 DGEFFKVRSANVQPVPAKPVDIWLGGSGPVALARIGRLADGWLGSFLTPVEAGAARRTIEREAQAAGREIEPDHYGISLA 223 Mycobacterium s...
WP_011894107 138 SGEFFSVRDVEVLPKPASHLDIWLGGSSRAGYRRIGELGDGWLGSFVTPDEARDAVRTIRAFAEAAGREVPEDHYGINLA 217 Mycobacterium g...
WP_011725079 139 TGRYFSVTGAAVTPKPAPPLDIWLGGSAPAALRRIGALADGWLGSFLTPAEARAGREAIERAAAAAGRHIEPDHFGISLA 218 Mycobacterium a...
WP_011602001 163 HGRFFDFTDVGIGELPTRPLDIWLGGAAPAALRRIGRFGDGWLASLVSPEQAAAGITEINAAAAAAGRRIDDDHFGLSLR 242 Frankia alni
WP_014877740 224 VAAGDIPDDVYDMARRRRPEVDPAELIAADWPTLHRRIDAYVDAGLTKFVVRPVGSGD-REAFLERFVGELLPRQN 298 Mycobacterium smegm...
WP_011894107 218 VGDGDLPAPVIAAIRTRRPDLDPEELVARDWAQLHRRLDRYIDAGLTKFVIRPAGRGS-IDAFLDAFVTELLPREN 292 Mycobacterium gilvum
WP_011725079 219 VADGELPPPAIAAVRRRRPDLDPDELIASGWDQLHRKLDAYLDAGLTKFVIRPAGTAP-WDGFLDRFVTELVGRQN 293 Mycobacterium avium
WP_011602001 243 VAFAPPSAESLAALRGRYPDVDPARLLPVGWAAARELIGEYLAVGVSKFVIHPMTTPDgWPSFLDSFAAELMPLEN 318 Frankia alni
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap