Conserved Protein Domain Family
sucrose_gtfA

?
TIGR03852: sucrose_gtfA 
sucrose phosphorylase
In the forward direction, this enzyme uses phosphate to cleave sucrose into D-fructose + alpha-D-glucose 1-phosphate. Characterized representatives from Streptococcus mutans and Bifidobacterium adolescentis represent well-separated branches of a molecular phylogenetic tree. In S. mutans, the region including this gene has been associated with neighboring transporter genes and multiple sugar metabolism.
Statistics
?
PSSM-Id: 163564
View PSSM: TIGR03852
Aligned: 8 rows
Threshold Bit Score: 885.617
Threshold Setting Gi: 502938184
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_004907394   5 NKAMLITYADSLGSNIKEVHQVLKEDIGDAIGGVHLLPFFPSTGDRGFAPSDYTRVDATFGDWNDVEALGQEYYLMFDFM 84  Leuconostoc cit...
WP_002262875   5 NKTMLITYADSLGKNLKELNENIENYFGDAVGGVHLLPFFPSTGDRGFAPIDYHEVDSAFGDWDDVKCLGEKYYLMFDFM 84  Streptococcus m...
WP_012582061   5 NKAMLITYSDSLGKNMEELSKVMETYFEDAIGGIHLLPFFPSTGDRGFAPSDYTTVDSDLGSWEMIEKLGEKYYLMFDFM 84  Listeria monocy...
WP_004904914   6 NEAMLITYADSLGKNLKELNQVLSNELDGVVGGVHVLPFFPSTGDRGFAPEEYETVDPKFGDWSDIDKLAEKYYLMFDFM 85  Leuconostoc cit...
WP_002937311   5 NQAMLITYSDSLGKNLKDLKKVLEGPLKDVVGGIHILPFFPSSGDRGFAPMDYTKVDPAFGDWSDIEALSKDYYLMFDFM 84  Streptococcus suis
WP_006586392   5 NKVMLITYPDSMGHNLKDLNFVLENYLKGAIGGLHILPFFPSAGDRGFSPMTYDKVDDQFGDWSDIEALSSKYYTMFDFM 84  Lactobacillus j...
WP_023355866   6 NRIMLITYADCMGNNLKDLSKVLDKHFSKALGGVHILPFFPSSGDRGFAPMRYDIVDETFGDWEDVTRLSEKYYLMFDYM 85  Catonella morbi
WP_013173160   5 NEIMLITYADSLGKNLKELDEVLETHFKDAVGGVHLLPFYPSSADRGFAPMTYQEVDPAFGGWSDVERIAKKYDTMYDFM 84  Bacillus seleni...
WP_004907394  85 INHISRESEMYQDFKANHDQSKYRDFFIRWEKFWQqagPDRPTQEDVDLIYKRKDKAPIQEITFADGTTEHLWNTFGEEQ 164 Leuconostoc cit...
WP_002262875  85 INHISRQSKYYKDYQEKHEASAYKDLFLNWDKFWP---KNRPTQEDVDLIYKRKDRAPKQEIQFADGSVEHLWNTFGEEQ 161 Streptococcus m...
WP_012582061  85 INHISRESLFFQDFKKEHLNSKYKDMFIRINDFFP---PGRPNEKDLDLIYKRKDKAPFQEVEFADGETELVWNTFGEEQ 161 Listeria monocy...
WP_004904914  86 LNHISPQSKYFQDFLEKKEASEYYDMFLKYSEFWP---ENRPTEADIDLIYKRKDKAPFAPVTFADGTTDQVWNTFGDQQ 162 Leuconostoc cit...
WP_002937311  85 INHISAKSPYFLDFLEKKDESDYADLFIRYKNFWP---NGEPTQEDVDLIYKRKPRAPYRIATFADGSEEKVWCTFDEQQ 161 Streptococcus suis
WP_006586392  85 INHLSKHSEYYKDFVKNKDKSKYKDLYLNWDKFWP---ENRPTQADVDLIYKRKDRAPYQTIEFADGSKTNIWNTFGEDQ 161 Lactobacillus j...
WP_023355866  86 LNHISAQSPYYKDFLKNKDNSPYKDLFIRYKDFWE---NGEPTEAEVDAIYKRKPRAPYVEAHFEDGTTEKVWCTFDEEQ 162 Catonella morbi
WP_013173160  85 INHISKSSEYFQDFMEKKDDSPYADLFIQYKDFWP---GGEPTQEDVDKIYKRKPRAPYIDVTFGDGSTEKIWCTFDEEQ 161 Bacillus seleni...
WP_004907394 165 IDIDVNSQIAKAFIKATLEDMVQHGANLIRLDAFAYAVKKVGTNDFFVEPEIWAVLNEVRDILAPMHAEILPEIHEHYTI 244 Leuconostoc cit...
WP_002262875 162 IDLDVTKEVTMDFIRSTIENLAANGCDLIRLDAFAYAVKKLDTNDFFVEPEIWTLLDKVRDIAAVSGAEILPEIHEHYTI 241 Streptococcus m...
WP_012582061 162 IDLDVTAEVTKEFIRQTIKNMAAHGCSILRLDAFAYAIKKLDTNDFFVEPEIWDLLDEVKAEAAKYDMELLPEIHEHYSI 241 Listeria monocy...
WP_004904914 163 MDLDVTKEVTKKFIKDSLVNLAHHGASVIRLDAFAYAIKKLDTNDFFVEPEIWNILDEVREILAAEGSEVLPEIHEHYKI 242 Leuconostoc cit...
WP_002937311 162 IDLDVTTETTRRFIQENLEQLAEHGASIIRLDAFAYANKKLGTNCFFVEPDIWEMLHFPRQLLAPKDVEILPEIHEHYTI 241 Streptococcus suis
WP_006586392 162 LDLDIRTDTTKKFVKDNLVNLANHGASLIRLDAFAYAVKKLDTNDFFVEPEIWDLLKEANDDLKGTDAQLLPEIHEHYKY 241 Lactobacillus j...
WP_023355866 163 IDINCPSDTAKRFLVDNLTGMAKRGAAIIRLDAFAYATKKAGTSCFFVEPYVWELLAEVTDVLTPTGVTILPEIHEHYTI 242 Catonella morbi
WP_013173160 162 IDLNVYHERTKAFMRENLTFLAEKGASIIRLDAFAYATKKPGTDCFFLEPDTWEMLDEIQTILEPIGCEILPEIHEHYTI 241 Bacillus seleni...
WP_004907394 245 PQKINAHGYFTYDFALPMTVLYTLYSGKTNRLANWLKQSPMKQFTTLDTHDGIGVVDARDILTDEEIDYASEELYKVGAN 324 Leuconostoc cit...
WP_002262875 242 QFKIADHDYYVYDFALPMVTLYSLYSSKVDRLAKWLKMSPMKQFTTLDTHDGIGVVDVKDILTDEEITYTSNELYKVGAN 321 Streptococcus m...
WP_012582061 242 QMKIANHDYYIYDFALPMVMLYSLYSGRVERLAKWLEMSPMKQFTTLDTHDGIGVVDARDLLTDEELDYTSAELYKIGAN 321 Listeria monocy...
WP_004904914 243 VRKITEHDMYSYDFALPLITLYSLYSGKTNRLADWLRQSPMKQFTTLDTHDGIGVVDAKDLLTQEETDFTTEEMYKVGAN 322 Leuconostoc cit...
WP_002937311 242 QQKIAEQDYYVYDFALPMLVLHALYSGHVNRLVHWMEICPRKQFTTLDTHDGIGVVDVKDLLTDEETEETREALYAQGAN 321 Streptococcus suis
WP_006586392 242 PFKVSEHGYFIYDFALPMVLLYSLYNGKSKRLADWLRKSPMKQFTTLDTHDGLGVVDAKDILSDDEIDMTTNELYKVGAN 321 Lactobacillus j...
WP_023355866 243 PFKIAEKGYFVYDFALPMLLLNSLYYGQTKYLKDWLLKCPNKQFTTLDTHDGIGVVDVKDLLPDEEIERTKEDIFKFGAN 322 Catonella morbi
WP_013173160 242 QLKLAERGYYVYDFALPMLVLHALYSGRTDRLAHWLNIAPRKQYTTLDTHDGIGVVDVADLMTQEEIEATRDDLFTKGAN 321 Bacillus seleni...
WP_004907394 325 VKKTYSSAAYNNLDIYQINSTYYSALGNDDAAYLLSRVFQVFAPGIPQIYYVGLLAGENDIDLLESSKEGRNINRHYYTR 404 Leuconostoc cit...
WP_002262875 322 VNRKYSTAEYNNLDIYQINSTYYSALGDDDQKYFLARLIQAFAPGIPQVYYVGFLAGKNDLELLESTKEGRNINRHYYSS 401 Streptococcus m...
WP_012582061 322 VKKIYSSEKYNNLDIYQINSTYYSALGDDDKSYLLARVIQCFAPGIPQIYYVGLLAGKNDIDLLEETKEGRNINRHYYTI 401 Listeria monocy...
WP_004904914 323 VKKIFSSAAYNNLDIYQINTTYYSALGNDDAAYLLARAAQIFAPGIPQIYYVGLLAGENDIELLESSKEGRNINRHYYDL 402 Leuconostoc cit...
WP_002937311 322 VKKIYSTEAYNNLDIYQINCTYYSALGNNDQAYLLARVLQCFAPGIPQIYYVGLLAGENDIELLESSKEGRNINRHYYDL 401 Streptococcus suis
WP_006586392 322 VKRKYSSAEYHNLDIYQINTTYYSALGDDDKKYFISRLVQVFAPGIPQVYYVGLLAGQNDLKLLEETKEGRNINRHYYEV 401 Lactobacillus j...
WP_023355866 323 VKKIYNTAAYNNLDIYQVNCSYYSACGDNDDAYLLARAVQFFAKGIPQVYYVGLLAGKNDLKLLEETKVGRNINRHYYTL 402 Catonella morbi
WP_013173160 322 VKRVYNTMEYNNLDIYQLNCTYYSALGDDDQAYLLARAIQFFAPGIPQVYYVGLLAGKNDIELLEETKVGRNINRHYYTK 401 Bacillus seleni...
WP_004907394 405 EEIKSAVKRPVVADLLALLSWRNQFSAFALDGTITVETPSEHD-IKITRTDHSGDNIAILLANAKTRTFVITAN 477 Leuconostoc citreum
WP_002262875 402 EEIAKEVKRPVVKALLNLFTYRNQSAAFDLDGRIEVETPNEAT-IVIERQNKDGSHIAKAEINLQDMTYRVTEN 474 Streptococcus mutans
WP_012582061 402 DEIKNEVKRPVVKALCNLLRFRNTSEAFDLEGSIEIETPSSNE-IVIIRKNKTNKITATLKANLSTKTFQISEN 474 Listeria monocytogenes
WP_004904914 403 AEIAETTKRPVVSNLFNLLRFRNTSSAFDLDGTIDVINDGENE-LTITRTSADGKTTAVLDANFETKQFTVTEN 475 Leuconostoc citreum
WP_002937311 402 EEIEQEVQRPVVQSLFKLLKFRNTSPAFD--GEFSVKMLDETS-MEIFWNNQDAGVSARLTANLKEKSFEIVEI 472 Streptococcus suis
WP_006586392 402 DEVADEVKRPVVAKLLNLLRFRNEEEAFDLEGSIDITTPSESQ-IQIVRENKDKTRKAVLNLDLASLEYSVEVN 474 Lactobacillus jensenii
WP_023355866 403 EEVDEEVERPVVRNLLKLMEFRNTSKAFALDGKFEILPTDEDK-LHIIREA--EGEKAELIADFKTKKFKILSN 473 Catonella morbi
WP_013173160 402 EEIAEEMKRPVMAKFMKLMTFRNDYKAFD--DQIDITEREDGQvLEIVRTT--GDNQAILTANVETHAFTITYK 471 Bacillus selenitiredu...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap