1QWG


Conserved Protein Domain Family
arch_ComA

?
TIGR03849: arch_ComA 
Click on image for an interactive view with Cn3D
phosphosulfolactate synthase
This model finds the ComA (Coenzyme M biosynthesis A) protein, phosphosulfolactate synthase, in methanogenic archaea. The ComABC pathway is one of at least two pathways to the intermediate sulfopyruvate. Coenzyme M occurs rarely and sporadically outside of the archaea, as for expoxide metabolism in Xanthobacter autotrophicus Py2, but candidate phosphosulfolactate synthases from that and other species occur fall below the cutoff and outside the scope of this model. This model deliberately is narrower in scope than pfam02679. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other, Energy metabolism, Methanogenesis]
Statistics
?
PSSM-Id: 163561
View PSSM: TIGR03849
Aligned: 7 rows
Threshold Bit Score: 382.901
Threshold Setting Gi: 499328272
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1QWG_A        15 LTVVLDKGLPPKFVEDYLKVCGDYIDFVKFGWGTSAVIDRDVVKEKINYYKDWGIKVYPGGTLFEYAYSKGKFDEFLNEC 94  Methanocaldococ...
WP_010869753  15 LTVVLDKGLPPKFVEDYLKVCGDYIDFVKFGWGTSAVIDRDVVKEKINYYKDWGIKVYPGGTLFEYAYSKGKFDEFLNEC 94  Methanocaldococ...
WP_011972877  15 ITMVMDKGLPPSYIDDYLKVCGEYITFVKFGWGTSAVQDKEIVKEKIKIYKKHNIKAYAGGTLFELCHSKGLYDEYLKEC 94  Methanococcus a...
WP_012067807  15 NTMVIDKGLSPDFINDYLKVCGKYITFAKFGWGTSAVQPRDVVKEKIENYKKYGIKTYPGGTLFEVCFSKDVFDEFLKEC 94  Methanococcus m...
WP_011406846  16 NTMVLDKALGYKTVEDMLTISGNYFNLLKYGWGTSILYDEEIIKDKNELYHSYNIRTYTGGTLFELANKQNKIDEYFNEI 95  Methanosphaera ...
WP_011018764  16 ATVMLDKGLTPEFVESFLKVAGEYVTAVKLGWGTARLIDKEIVARKVEMYVDAGLDVFPGGTLAEIAIAQGNFEGYLNEL 95  Methanopyrus ka...
WP_010877281  20 ITMVLDKGMGPASARDLMEISSDYVDFIKFGWGTLPLHRRDTVKEKVDMYRSFDVEPYPGGTLFEIAHLNDKVEEYFQEA 99  Methanothermoba...
1QWG_A        95 EKLGFEAVEISDGSSDISLEERNNAIKRAKDNGFMVLTEVGKKMPDKDKQLTIDDRIKLINFDLDAGADYVIIEGRESGK 174 Methanocaldococ...
WP_010869753  95 EKLGFEAVEISDGSSDISLEERKNAIKRAKDNGFMVLTEVGKKMPDKDKQLTIDDRIKLINFDLDAGADYVIIEGRESGK 174 Methanocaldococ...
WP_011972877  95 KELGFGCIEISDGSMELSKEDRKNAIRKAKQNGFIVLSEVGKKSIEEDSKLTTEDRINIINEDLRAGSDFVIMEGRESGK 174 Methanococcus a...
WP_012067807  95 KDLGFECVEISDGSMELKPEDKDYAIKQAKKAGFIVLSEVGKKSIVLDGELEIHERIELVKKDLESGADFVIIEGRESGK 174 Methanococcus m...
WP_011406846  96 DRLGFNAVEISDGSTTIDSDRRAQLINKSKELGFYTLSEIGKKNPQKDSEYTTQQRIDLINTDIEAGSDMVIIEGRESGK 175 Methanosphaera ...
WP_011018764  96 DELGFNAIEISDGMIPMSIEKKCELIERACEQGFTVYAEEGKKRDEEYSVLSPSDIVGRMNKCVEAGAEYVIVEARESGK 175 Methanopyrus ka...
WP_010877281 100 RSLGFETLEISNGTVEIETEEKCRLIEMAVDEGFMVLSEVGKKDPERDRLLEPDDRVRLVRADLRAGASMVLMEARESGQ 179 Methanothermoba...
1QWG_A       175 GKGLFDKEGKVKENELDVLAKNVDINKVIFEAPQKSQQVAFILKFGSSVNLANIAFDEVISLETLRRGLRGDTFGKV 251 Methanocaldococcus...
WP_010869753 175 GIGLFDKEGKVKENELDVLAKNVDINKVIFEAPQKSQQVAFILKFGSSVNLANIAFDEVISLETLRRGLRGDTFGKV 251 Methanocaldococcus...
WP_011972877 175 SIGLFDEKGNLKDKEFKKMLEYIDTNKIIFEAPNKNQQVEFILSIGSNVNLGNIAYEEVISLKTLRTGLRGDTFGKI 251 Methanococcus aeol...
WP_012067807 175 SIGLFDEKGNVKKEELEILAENVDMSKIMLEAPQKNQQVEFILRFGNDVNLGNISFEEVISLETLRRGLRGDTFGKI 251 Methanococcus mari...
WP_011406846 176 NIGIYDDKGNVKKDDLTSIYENTPKEKVLWEAPQKNQQVELILTLSNDVNLGNINSNEIVSLETLRRGLRGDTLGKL 252 Methanosphaera sta...
WP_011018764 176 -HGPMGAEKRERVRVLSEIVKGVGIQRVMFEAPEKEQQFELIVKFGPEVNIANVPPEEVIPLATLRAGLRAETMGRV 251 Methanopyrus kandleri
WP_010877281 180 NIGIYDERGNIREDEFNHLTDRLPMDRIIWEAPQKSQQVYFILKIGPDVNLGNIPPEEITALETIRRGLRGDTLGKV 256 Methanothermobacte...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap