Conserved Protein Domain Family
MSMEG_4193

?
TIGR03848: MSMEG_4193 
probable phosphomutase, MSMEG_4193 family
A three-gene system broadly conserved among the Actinobacteria includes MSMEG_4193 and homologs, a subgroup among the larger phosphoglycerate mutase family protein (pfam00300). Another member of the trio is a probable kinase, related to phosphatidylinositol kinases; that context supports the hypothesis that this protein acts as a phosphomutase.
Statistics
?
PSSM-Id: 163560
View PSSM: TIGR03848
Aligned: 16 rows
Threshold Bit Score: 308.522
Threshold Setting Gi: 500590184
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011756068   3 TVILVRHGRTTANAAGTLTGRLPGVRLDDTGAAQAVRAAERLSGVPLAAILSSPLERCRQTAKAIATARtePV------- 75  Nocardioides sp...
WP_031334522   3 TLILLRHARSAANGSGTLAGRTAGVGLDETGRVQAEGLAGRLSGIPVSALVASPLQRCQDTVAGLAEKL--GV------- 73  Saccharopolyspo...
WP_012038908   3 TVILVRHGRTTANATGILAGRTPGVDLDDTGREQADRAGDRLAAVPLAAVVCSPLQRCWETAQRILERQp-GK------- 74  Clavibacter mic...
WP_003977159   3 TLILVRHGRSTANTEGLLAGWTPGVALDERGAAQAAALPGRLAGLPLSEIVTSPLQRCQETLRPLLDARp-EL------- 74  Streptomyces
WP_011594100   2 TVVLLRHGRSTSNTAHTLAGRSPGVELDDRGREQAQAIVSRLADVAIEEIVHSPLVRCEQTVEPLARAR--GL------- 72  Rhodococcus
WP_011720004   3 TVIFLRHG-LTESTGRLLTGRMPGVHLDSRGLAQAADLAKRLAGIRLSAIVSSPLERCRETVQPIADQT--GL------- 72  Acidothermus ce...
WP_011437042   3 TVLLVRHG-LTAVTGKILLGWTPGVGLDDRGRRQASDLARRLADIPLAAIVSSPLDRCRQTAAAIAGRR--PVseaspgg 79  Frankia
WP_016188853   2 TLLLVRHG-LTAATGKTLAGWTPGIHLDERGRAQAAALAQRLASLRVDAIVSSPLERCVETAQAVADTV--GV------- 71  Thermobifida fusca
WP_011774635   3 TVILVRHGRTTANATGLLAGRALGVSLDQTGRDQAALTGERLAAVPVVAVVSSPLERCRQTASIILDRQa-GT------- 74  Arthrobacter au...
WP_011906046   6 TLLLLRHGRTTANAAGGLAGRQP-VELDETGRDQAAAVGERLRLLSCATVVTSPLVRCRQTLDLALP----EA------- 73  Salinispora
WP_011756068  76 --RVT-TDRGITECDYGSWQGRPLEELAKEKLWSTVQTQPSAAVFPE--GEAMSAMQARAVAAVRRQDAALESEHGPGAV 150 Nocardioides sp...
WP_031334522  74 --PVA-VEDRLAEVDYGQWTGRAVKDLTQEPLWKVVQQHPSAAVFPG--GEALAQVQARAVEAVREHDRRISGEFGPHAV 148 Saccharopolyspo...
WP_012038908  75 --PAQpVDPDLTECDYGDWQGRPLSELATEDLWKTVQAHPSAVVFPG--GESMAGMQARAVAAIRRHDAEIEAEHGPGAV 150 Clavibacter mic...
WP_003977159  75 --RAH-TDERIGECHYGDWSGRKLAELGNEPLMEVVQAHPSAAAFPG--GESMRAMQTRAAEAVREWNARVERDHGPDAV 149 Streptomyces
WP_011594100  73 --TPV-VEHRLVEVDYGEWTGRELKVLLEEPLWKIVQQHASAAVFPG--GEGLAQVQARAVAAVREHDARLAELHGRDVV 147 Rhodococcus
WP_011720004  73 --PIE-IEPGVIECGYGDWTGRDLRHLTKDPLWRILQTHPSSVVFPGaeGESLRAVQYRAVDAVRAWNARL----GAKAA 145 Acidothermus ce...
WP_011437042  80 prQVE-IDERLGECRYGDWTGQELATLAKDPLWAVVQSHPSAVVFPGpeGEALRDTQARGVSAVREWNERL----GPDAT 154 Frankia
WP_016188853  72 --PVT-VDERFGECRYGEWTGRPLTELAKDDLWPVVQAYPSAARFPG--GESLAETAHRAVSAVHDYNTRLLAQH-DTPV 145 Thermobifida fusca
WP_011774635  75 --PFApVDPDLNECDYGQWQGRKLSELATEDLWPVVQSQPSAVVFPG--GESMAAMQARSVAAIRRHDAAFEAEFGPGAV 150 Arthrobacter au...
WP_011906046  74 --VPV-VEEGLTECGYGSWEGQPLKQLAKEPLWPVVQQHPSAAVFPG--GEAMATMAARAVAAVRTWDARVNEGHGPDAV 148 Salinispora
WP_011756068 151 WVAVSHGDVIKSVLADALGMHLDLFQRLQVDPASMSVIRYTAARPYVLATNTHAGDLS 208 Nocardioides sp. JS614
WP_031334522 149 WVACSHGDVIKAVLADALGLHLDGFQRIVVDPCSVSVVRYTETRPFVLRVNDTGGDVS 206 Saccharopolyspora erythraea
WP_012038908 151 WVAVSHGDVIKSILADAYGMHLDLFQRIDVGPASLSIVRYGAGRPTVHATNTDAGDLS 208 Clavibacter michiganensis
WP_003977159 150 YLMCSHGDIIKSLVAEALGLHLDLFQRISVEPCSVTAIRYTRLRPFLVRLGDTGdfas 207 Streptomyces
WP_011594100 148 WVACSHGDVIKSVLADALGAHLDGFQRIVAEPASISVVRYTSTRPYVLKMNDTGADLS 205 Rhodococcus
WP_011720004 146 WLCCTHADVIRLVLADALGMHLDEFQRLIIDPCSVSIVRYTTTRPFVLRVNDTGGDLA 203 Acidothermus cellulolyticus
WP_011437042 155 WLLCSHGDVIRTVVADALGMHLDMYHRITVDPCSLTVIRYNERRPFVRRINDTGGDVv 212 Frankia
WP_016188853 146 YLVCSHGDVIKAILADALGLHLDQFQRIQIDPCSLSAVRYTRLRPFVLRINDVGGGTA 203 Thermobifida fusca
WP_011774635 151 WVAVSHGDVIKSILADALGMHLDLFQRLNVSPASASIINYSASRPSVYATNTEAGDLE 208 Arthrobacter aurescens
WP_011906046 149 WLACTHGDVIKAIVADALGLHLDLFQRIVVDPASVTVIRYTPLRPFLVRLNDTGGDLT 206 Salinispora
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap