Conserved Protein Domain Family
sulfopyru_alph

?
TIGR03845: sulfopyru_alph 
sulfopyruvate decarboxylase, alpha subunit
This model represents the alpha subunit, or the N-terminal region, of sulfopyruvate decarboxylase, an enzyme of coenzyme M biosynthesis. Coenzyme M is found almost exclusively in the methanogenic archaea. However, the enzyme also occurs in Roseovarius nubinhibens ISM in a degradative pathway, where the resulting sulfoacetaldehyde is desulfonated to acetyl phosphate, then converted to acetyl-CoA (see ). [Biosynthesis of cofactors, prosthetic groups, and carriers, Other, Energy metabolism, Methanogenesis]
Statistics
?
PSSM-Id: 163557
View PSSM: TIGR03845
Aligned: 15 rows
Threshold Bit Score: 252.961
Threshold Setting Gi: 500684612
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011973896   4 SKSVYNALIDSGISFVAGVPCANLDNLIKLIENkkdgknkkesD--IQYVIATREEEAVGICGGAHLANKRTAILMQNSG 81  Methanococcus a...
WP_011032088   5 EEEVITLMKKAGIDLVATLPCDRIKNLLPLVSK----------N--FPEIKMTREENGVGICAGFYLAGGKPLMLIQSTG 72  Methanosarcina ...
WP_011023231   7 EEKVIEIMKQTGIDLAATLPCDRIKNLLPLVSE----------N--FPEIKLTREENGVGICAGIYLAGGKPMMLIQSTG 74  Methanosarcina ...
WP_012037094   4 EQAVIDVMKQCGIDTVLTLPCDRMKNFLPLIPK----------N--FREIPLSREEGGVGIAAGLYMSGKKPAMVIQSTG 71  Methanocella ar...
WP_011308450   5 EEEVIAIMKKSGIDLAATLPCDRIKNLLPLVSE----------N--FPEIKLTREENGVGICAGFYLAGGKPMMLIQSTG 72  Methanosarcina ...
WP_011696768  32 SEQVYRGLKRAGIDLVASVPCVNLQELLCLLSS----------DpdIIHIPVTREEEGIGVCAGAYMGGMSPAIAMQNSG 101 Methanosaeta th...
WP_011449916   3 EQTVSGILKKEAIEYIISLPCDRTKDLCEILEK----------E--YRYITISREEDGIGILSGLSLMGKRGVLQMQSSG 70  Methanospirillu...
WP_011499509   7 STAVFDSLKLTGVDLVVSVPCINLKDVLTMIDN----------DptMLHIPVTREEEGVGICAGAYMGGRIPVMLMQNSG 76  Methanococcoide...
WP_011832879   3 EETVLRIMHEEGIDMVASLPCDKNKRFTALLET----------E--FSVIDLAREEDGVGIGAGVVLAGKRPLVSIQSSG 70  Methanocorpuscu...
WP_011405888   4 TDVIYNGIKDAGINFIVSVPCANLKKLLELIDK----------DdtIKHVPVTREEEGFGICAGAYMGGLKPAILMQNSG 73  Methanosphaera ...
WP_011973896  82 LGNCINAIGSFCKIYDIPILFIISHRGELKEQIPAQIPMGKWTKKLLETVDIPYYCPKTPEEAyKYICLGSDYAETMGAP 161 Methanococcus a...
WP_011032088  73 LGNMINALESLNVTCKIPLPVLTSWRGVYKEAIEAQVPLGVHLPAILEGAGLAYTIIDEVEKL-HQIENVISDAFENSRP 151 Methanosarcina ...
WP_011023231  75 LGNMINALESLNVTCKIPLPILASWRGVYKEGIEAQVPLGAHLPSILEGAGLTYTIIGETEKL-PLLENVILDAFENSRP 153 Methanosarcina ...
WP_012037094  72 IGNSLTALSSLHKTYDLPLPILASWRGVYKESIQAQVHFGKFLPGVLDNMGIPYLVAEKPADL-PAVRKAIDQSYKENTP 150 Methanocella ar...
WP_011308450  73 LGNMINALESLNLICRIPLPVLASWRGVYAEGIEAQVPLGAHLPAILEGAGLEYSIIDEAEKL-PLLETVIKDAFENLRP 151 Methanosarcina ...
WP_011696768 102 LGNSINALASLDMLYGIPLLMVISHRGTQGERLVGQIPMGRLTEPLLKTMGIPFFRPRPHEAE-KAVEGAWSLALNEMRP 180 Methanosaeta th...
WP_011449916  71 LGNSLNALMTLPYLYGLPLPILASWRGYYQEKISAQIPFNEKIPDLLRLYNIPCTIIREPEDI-DRITSVISDAWIENRP 149 Methanospirillu...
WP_011499509  77 LGNSINALASLNNLFHIPLLLIMSHRGCEGETICAQYPMGQMTPSLLDTLGIPYVVPTIDTVE-DAIHYAWRIAIEKKRP 155 Methanococcoide...
WP_011832879  71 LGNMLNALLSLSCVYHFPLPILASWRGVCDEKICAQIPFNAPLPKLLDVYNIPYRICRSAEDL-EGIREVIKGAFTQQTP 149 Methanocorpuscu...
WP_011405888  74 LGNSVNVLASLMKLYNFPILMIISHRGSLGEAVYGQIPMSKATTKVLDSLDIRYYKVDYPSESrEIINKSWNLSLISEEP 153 Methanosphaera ...
WP_011973896 162 VAILLDAIYW 171 Methanococcus aeolicus
WP_011032088 152 HIALISPKVW 161 Methanosarcina mazei
WP_011023231 154 HIALVSPKVW 163 Methanosarcina acetivorans
WP_012037094 151 YVILFSPKIW 160 Methanocella arvoryzae
WP_011308450 152 HIALISPKVW 161 Methanosarcina barkeri
WP_011696768 181 VAVLLDIKFW 190 Methanosaeta thermophila
WP_011449916 150 HVALISPKVW 159 Methanospirillum hungatei
WP_011499509 156 VAVLLEIGFW 165 Methanococcoides burtonii
WP_011832879 150 YVALILPSCW 159 Methanocorpusculum labreanum
WP_011405888 154 IALLFDISYW 163 Methanosphaera stadtmanae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap