Conserved Protein Domain Family
cysteate_syn

?
TIGR03844: cysteate_syn 
cysteate synthase
Members of this family are cysteate synthase, an enzyme of alternate pathway to sulfopyruvate, a precursor of coenzyme M. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other, Energy metabolism, Methanogenesis]
Statistics
?
PSSM-Id: 163556
View PSSM: TIGR03844
Aligned: 8 rows
Threshold Bit Score: 664.508
Threshold Setting Gi: 501056222
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q8TKU7         4 FILKCLKCGREYSQEYRLTCENDD-S-FLRAEYLEKKLELR-KQPGIGRFHSWLPVQEELTTEAG-P-ITYKSEALAREL 78  Methanosarcina ...
WP_011449917   4 YTLTCPVCNKEFSDSYTLTCPGGCqG-LIRAKYAARQITLH-DAPGVFKYMDWLPVTGVLRTRAE-P-VCFKSEGLARAL 79  Methanospirillu...
WP_011832878   4 YVLRCLTGGEVLEDHYTLACPHHP-G-FVRAEYTAKQLTVReNLPGVFRFSDWLPVRGSVPTRSR-P-VTFQNRELCREL 79  Methanocorpuscu...
WP_011842967   5 YLLHCPGCGRLFPDNYTLDCPLGCnA-LLRTVYAEHRLTLR-DLPGIFRYSSWLPIEGHLRIDAG-P-VSYASEGLAREL 80  Methanoculleus ...
WP_012037095   4 YTLVCPCSGKTVPDHYTLNC--DC-GsLIRTEYAARQLTLR-NLPGMWKFYDWLPASGHTDTPGT-T-VTYRSEGLAKEL 77  Methanocella ar...
WP_011499505   4 YIVKCPGCGEVR-DQYALHCPDDD-A-LPRTEYFKKQIVPA-DMPGMWRYYDWLPVNGIIEKGSGrP-VTYKSEGFAKEL 78  Methanococcoide...
WP_011695866  20 YTLRCAGCGNLL-IGGAASCPLDG-G-LPRADYIERRFNPR-KLPGIWSFIDWLPVDGWNRSTGA-SsVTYRSSGLAAEL 94  Methanosaeta th...
WP_012107688   5 YRIRCISGGEIVPDITSLSCPAGHdS-LLRTEYTSRRLQLS-YHSGIFRYLCWLPVTAPLLPSGG-P-VTFTSDELSREL 80  Methanoregula b...
Q8TKU7        79 GLSNLYIGFSGYWPEKGAFIKTCSFKELEAHPTMQLLKES-GGKAIVLASAGNTGRAFAHVSALTGTDVYIVVPDSGIPK 157 Methanosarcina ...
WP_011449917  80 GLSDLWIVFSGYWPEVGAFAVSGSFKEFEAFPTMQRLSER-TKGIIQVSSAGNTGRAFAEVSAETCQPVIIVVPESARDR 158 Methanospirillu...
WP_011832878  80 GQPNLWITFTGYYPERGCYVPTGSFKELEALPTIVRLNEA-GGGTLVVASAGNTGRAFAQMSAEFGTPVVLVVPESSADK 158 Methanocorpuscu...
WP_011842967  81 GLSNLTVTFSGYWPERGGRMETCSFKELEAQPTVLRLGEK-GAGVLQISSAGNTGRAFCQVSALTGAPVVVVVPASAADR 159 Methanoculleus ...
WP_012037095  78 GI-DLHVAFNGYWPELGADMKTCSFKELEAPPTIVRAKEH-GGKAMVLASAGNTARAFSYLSTITGFPLIVVVPKQNIDR 155 Methanocella ar...
WP_011499505  79 RLSDLNITFNGYWPENEGFIRTCSFKDLESFPTMQRLLENnERRVLVVASAGNTARAFAHVASITGYPLLLIVPKNSTHR 158 Methanococcoide...
WP_011695866  95 GLDSLYISFSGYWPERGALMRTCSFKELEAAPTMQMLRDRkAGETLVVASAGNTARAFAEVCSITDQPLILFVPVSSLDR 174 Methanosaeta th...
WP_012107688  81 GLSRLAISFSGYSPEHHASLTTGSFKELEALATLQRLWEL-GKKIPVIASAGNTGRAFAGLSAQYGKPVVVVVPSSAVSR 159 Methanoregula b...
Q8TKU7       158 LWLP--EePTDSIHLISMTPgnDYTDAINLAGRIAKLPGMVPEGGARNVARREGMGTVMLDAAVTIGKMPDHYFQAVGSG 235 Methanosarcina ...
WP_011449917 159 LFTT--S-PAHDTLLITISG--DYTDAINLGSRICTLPGIFPEGGAKNVARRDGMGTVMLAGTLAMGTLPDWYLQAVGSG 233 Methanospirillu...
WP_011832878 159 LWTAgyF-DHSSIRLVTVRG--DYTDAIKTADKICEAPGFFPEGGGKNIARRDGMGCVMLDGAVTIGKLPEYYFQAVGSG 235 Methanocorpuscu...
WP_011842967 160 LWTT--V-PAPNVCLITVEG--DYSDSIAFGREVCSLPGIVPEGGAKNVARRDGMGTVMLDAALFAGRLPDAYFQAIGSG 234 Methanoculleus ...
WP_012037095 156 LWIPgrE-PGASVKLISVGGgcDYTDAINLSNRIAALPGMMPEGGAKNVARRDGMGTVMLDAAVTMKGMPDDYFQAIGSG 234 Methanocella ar...
WP_011499505 159 LWTT--EeDTSSVCTVTVDG--DYYQAIAMAEKIAARDGFVSEGGARNVARRDGMGTVMLDAVLTTKSLPQHYFQAVGSG 234 Methanococcoide...
WP_011695866 175 IWTT--V-EPGRVLVVGVKG--DYADAIKLADVLSSRSGFRAEGGARNIARRDGMGTVLLDHVRRFNSLPNHYFQAIGSG 249 Methanosaeta th...
WP_012107688 160 LWTT--T-PAQDVFLVAVDG--DYTDAIAVSTALATVPGCVPEGGARNVARRDGMGTTVLDAAVTLGRIPDHYFQAVGSG 234 Methanoregula b...
Q8TKU7       236 TGGISAWEASLRLREDGRFGSKLPKLQLTQNLPFVPMYNAWQEGRRDIIPEiDMKDAKKRIEETYATVLTNRAPPYSVTG 315 Methanosarcina ...
WP_011449917 234 TGGIAAYEASLRLIADGRFGTRMPRLLLFQNEPFIPMVRAWQEKRREIKDE-DMPDAEQAISQVYSDVLTNRTPPYGIVG 312 Methanospirillu...
WP_011832878 236 TGGIAAWEAAIRLIGDGRFGSKFPELHLSQNLPFVPMVRAWNAGRDHIIDE-DMPDAQASISAVSAHVLTNRTPPYGICG 314 Methanocorpuscu...
WP_011842967 235 TGGIAAWEAAERLVADGRFGSRLPTLHLSQNLPFVPMVRAWEAGRREIVPEvDMPDAEASIVRVSADVLTNRHPPWEVRG 314 Methanoculleus ...
WP_012037095 235 TGGIAAWEASMRLRADGRFGSKLPRLHLAQNLPFVPMLNAWKEGRREIIPErDMPDAKKSIAEMYSDVLSNRTPPYGVGG 314 Methanocella ar...
WP_011499505 235 TGGISAWEAAMRLIEDGRFGNNMPRLHLAQNLPCAPLYSTWTGEQTN----------GNCPEEMYDDVLFNRKPPYLATG 304 Methanococcoide...
WP_011695866 250 TGGIAVWEASMRIIEDGRFGERLPRLHLAQNTPCAPVYNMWHGMGSE---EsDF-DAYGCPEGMHDDVLFNRNPPYAVPG 325 Methanosaeta th...
WP_012107688 235 TGAIAAWEAALRLIGDGRYGTKLPRLHLAQNKPFTPIVLAWQQRRRTFKPElDMPDAPNAIKEVMSPVLTNRSPPYGIGG 314 Methanoregula b...
Q8TKU7       316 GLYDALVDTDGIMYAVSKEEALDAKALFESLE-GIDILPPSAVAAASLLKAVEAGNVGKDDTILLNIAGGGFKRLKEDFT 394 Methanosarcina ...
WP_011449917 313 GVFDTLIATNGLMAGVSSADAQEAGKLFSSSE-GIDPDPAAAVCVAGLMRAVRSGVIKPDEKILLNITGGGYARGRKDLP 391 Methanospirillu...
WP_011832878 315 GVYDAMKSCGGQMYTVENKDAASAASLFAEAEnGIDIDPAAAVAFASLISAAEEGSIRTNADILLNITGGGYQRVKKDCE 394 Methanocorpuscu...
WP_011842967 315 GVYDALAASGGRMYAVANDDTRSAGRLFEATE-EIDLDPAAAVAVASLIRAAEEGFIGPDDHILLNVTGGGYARAAEDLD 393 Methanoculleus ...
WP_012037095 315 GVFDAMKATDGLMYGITREEAVAAKKLFEARE-GIDILPPAAVAVAALVQASEKGLLE-GRKVVLNVTGGGQERLMKEVP 392 Methanocella ar...
WP_011499505 305 GVKDALDDTNGIIYGITNKEADEARKIFEENE-GIDILPAPAIACAAIMKALEKGEIKADENIVLNITGGGQKRLEEELP 383 Methanococcoide...
WP_011695866 326 GVRDAVISSGERIYGIDNSRAVSAQKLFEMSE-GIDILPAASVAVAALVDAVESGFVENDDDILLNITGGGVKRLAEDHS 404 Methanosaeta th...
WP_012107688 315 GLFDALQATEGQMYAVSNDEGKKGMALIRDTL-GIDPDPAAAVATAALVQAAAAGTVGPDDSILLNITGGGYERIREDYT 393 Methanoregula b...
Q8TKU7       395 LFQIEPEITV 404 Methanosarcina acetivorans C2A
WP_011449917 392 RFVKAPDIMV 401 Methanospirillum hungatei
WP_011832878 395 TAKIGVYETV 404 Methanocorpusculum labreanum
WP_011842967 394 RYPVEPYLRV 403 Methanoculleus marisnigri
WP_012037095 393 IYQVEPVLEV 402 Methanocella arvoryzae
WP_011499505 384 TRQLSVDLAL 393 Methanococcoides burtonii
WP_011695866 405 RVKLKCDLTV 414 Methanosaeta thermophila
WP_012107688 394 LYPIEPSVTV 403 Methanoregula boonei
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap