Conserved Protein Domain Family
F420_CPS_4043

?
TIGR03842: F420_CPS_4043 
F420-dependent oxidoreductase, CPS_4043 family
This model represents a family of putative F420-dependent oxidoreductases, fairly closely related to 5,10-methylenetetrahydromethanopterin reductase (mer, TIGR03555), both within the bacterial luciferase-like monoxygenase (LLM) family. A fairly deep split (to about 40 % sequence identity) in the present family separates a strictly Actinobacterial clade from an alpha/beta/gamma-proteobacterial clade, in which the member is often the only apparent F420-dependent LLM family member. The specific function, and whether Actinobacterial and Proteobacterial clades differ in function, are unknown. [Unknown function, Enzymes of unknown specificity]
Statistics
?
PSSM-Id: 163554
View PSSM: TIGR03842
Aligned: 13 rows
Threshold Bit Score: 587.451
Threshold Setting Gi: 501394586
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_013156156   2 DIGLVLQTDPPADLLVERMVRAEGYGFTHGWTFDSVVLWQEPFVVYSRILERTSGLVVGPMVTNPGTRAWEVTASLFATL 81  Nocardiopsis da...
WP_009773437   2 DFGAVLQTNPPASRTVQLAKLAEAHGFSHVWTFDSHILWQEPYVIYSQILAETRKIKIGPMVTNPATRDWTVTASTYATL 81  marine actinoba...
WP_009942325   2 DFGLVLQTDPPAWSVVDRMRKAERLGFTHGWTFDSCVLWQEPFVIHSQILSATERMVVGPMVTNPSTRDWTVTASTFATL 81  Saccharopolyspo...
WP_012378399   2 DFGLVLQTDPPASAVVGLMRRAERNGFRYGWTFDSAVLWQEPFVIYSRILEHTEKLTVGPMVTNPGTRTWEVTASTFATL 81  Streptomyces gr...
WP_013116665   2 DFGVVLQTNPPASRTVELARQAETHGFTHVWTFDSHLLWQEPFVIYSAILAATRKVMVGPMVTNPATRDWTVLASLFATL 81  Cellulomonas fl...
WP_003895005   2 HFGIVLQPDPPASRVVELAVAAENRGFDYVWTFDSHLLWQEPYVIHSQILSATRNVMVGPMVTNPLSRDVTVTASTHATL 81  Mycobacterium s...
WP_011563219   2 EFGVTFQTDPPAWRVVELTKRAEELGFACAWTFDSHILWQEPYVIHSQMLSATERIMVGPFVTNPATRDPSVTASVFATL 81  Rubrobacter xyl...
WP_011729474   2 DFGVVLQCNPPASRVVSLAAEAEDRGFSHVWTFDSHVLWQEPYVIYSQILAATRNVIVGPMVTNPLTRDDTVTASTFATL 81  Mycobacterium s...
WP_015800932   2 DFGVVLQTDPPARAVVESMRAAEGSGFGYGWTFDSVVLWQEPFVVYSQVLAATRNLVVGPMVTNPTTRDWSVTASLFATL 81  Actinosynnema m...
WP_012919379   2 DFGVVFQCDPPASAVVELAVQAERAGFSYVWTFDSHLLWQEPFVLYPQILAATRSVLVGPMVTNPGTRDWTVIASQFATL 81  Kribbella flavida
WP_012085973   2 DFGVVLQNTAPASRVVELARQAELHGFTHAWTFDSHLLWEEPYVVYSAMLAATRNIVVGPMVTNPLTRDWTVTASSYATL 81  Kineococcus rad...
WP_009831992   2 EFGITFKGFVSPNRARNLVRQAEEAGFDYCWFYDSHILWRESFVAMAMCMEHTKTMRFGPCVTNPNIRDWSLASSLYASL 81  Marinomonas sp....
WP_012426152   2 QFGICFKGFVEPDRARALVRLAEAQGFDYCWFYDSHILWRESFVAMAMCMEHTTRMRFAPCVTNPDVREWSLAASLYGSL 81  Burkholderia ph...
WP_013156156  82 NDMFGNRTVCGIGRGDSAMRVAGRRPATLERLSRAMRAIKDLAEGREADVE--GAALRLPWVRDG----ALPVWMGAYGP 155 Nocardiopsis da...
WP_009773437  82 NEMYGNRTICGIGRGDSAVRVTNGKPTTLKDLRESIHVIRELANSRSVEYG--GAQLQFPWSKGS----ELEVWVAAYGP 155 marine actinoba...
WP_009942325  82 NDMFGNRTVCGIGRGDSAVRVTGGRPNTLARLEEAMHVIKELAEGREVDLG--GTPVRMPWIRDG----SLPVWMGAYGP 155 Saccharopolyspo...
WP_012378399  82 NDMYGNRTVCGIGRGDSAMRVAGRRPNTLARLGEAIDVIRDLAEGREATVD--GQPVQLPWVKDG----KLPVWMAAYGP 155 Streptomyces gr...
WP_013116665  82 NEMYGNRTVCGIGRGDSAVRTLNGRPSNLATLRQSIHVIRELANDRPADLG--ERTVRFPWSKGS----ALDVWVAAYGP 155 Cellulomonas fl...
WP_003895005  82 NSMFGNRTVCSIGRGDSAVRTLSGKPSSLATLRAAVKVISDLGNGRPTEIN--GTTVQIPWASKS----TLDVYVGAYGP 155 Mycobacterium s...
WP_011563219  82 NEMFGNRTICGIGRGDSAQRVLGRKPATLGQVERAMHVIKELAEGREVDYG--GTRVRIPWVRGG----RLEVWMAGYGP 155 Rubrobacter xyl...
WP_011729474  82 NSMFGNRTVCGIGRGDSAVRVISGKPSTVTHLRESIEVIRALGNGGSATIN--GATVQFPWAARS----RLPVYGAGYGP 155 Mycobacterium s...
WP_015800932  82 NDMFGNRTVCGIGRGDSALRVLGRKPATLAELGSAMRVIKDLAEGREASPH--GVPVRIPWVRDG----KLEVWMAAYGP 155 Actinosynnema m...
WP_012919379  82 NETFGNRTICGIGRGDSALRTLGAQPGTLAELKQCVEVVRGLARGETVSYR--GQELKFGWVSAG----ALDVWVAAYGP 155 Kribbella flavida
WP_012085973  82 NEMYGPRTICGIGRGDSAVRTLAGRPSTLATLREAVHVIRELANGRSVEHR--GQTIRFPWARATheqdRTQVWVAAYGP 159 Kineococcus rad...
WP_009831992  82 ALQSEGRFDIGLGRGDSSMRVMGKKPAPLARVAEFTNKVKAMVRGEEVSYGecEEPVKLPWANGY----ELPVWIGAYGP 157 Marinomonas sp....
WP_012426152  82 ALQSKGRIDIGLGRGDSSRRVMGKKPASMDRVAAFTHAVKGMVRGDEVKYEdaEAPVRLPWATGY----ELPVWIAAYGP 157 Burkholderia ph...
WP_013156156 156 RALELAGRQADGFILQLADPYLTEWMVRAVRTAAADAGRDPDAVTVCVAAPAYVTDgserG-----LAHAREQCRWFGGM 230 Nocardiopsis da...
WP_009773437 156 LALKLTGEVGDGFILQLADVDIAEWMIKKVRDAAEAVGRDPMSIKFCVAAPMYIGD----D-----WEHMRDQCRWFGGM 226 marine actinoba...
WP_009942325 156 KALELVGRKADGFILQLADPVLTRWMVDHVREAARDAGRDPDSITVCVAAPAYVSD----D-----LGHARDQCRWFGGM 226 Saccharopolyspo...
WP_012378399 156 KALALAGQKADGFILQLADPFLTEWMIKAVRDAASDAGRDPDSVTICVAAPAYVGD----D-----LDHAREQCRWFGGM 226 Streptomyces gr...
WP_013116665 156 LALKLTGEVGDGFILQLADPDIARWMVRAVRDSAEAAGRDPDEVDICIAAPAYVGD----GaspaaRAHMREQCRWFGGM 231 Cellulomonas fl...
WP_003895005 156 RALDLCGQVADGFLLQLADPDITKWMIERVKNAAADAGRNPDDIKVCVGAPAYIGD----D-----LEHQRDQCRWFGGM 226 Mycobacterium s...
WP_011563219 156 KALSLAGRRADGFILQLADPVILEWTASRVREAAAAAGRDPEGLKICVAAPAYVGG----D-----LAHQREQCRWFGGM 226 Rubrobacter xyl...
WP_011729474 156 KVLDLIGRHADGFILQLADPAIVQWTVGRVRKAAEQAGRDPRDVTIVVASPAYVGD----N-----LAHQRDQCRWFGGM 226 Mycobacterium s...
WP_015800932 156 KALKLVGEQADGFILQTADPDIARWTIGAVREAAAGVGRDPASVTVCVAAPAYVGT----D-----LAHQREQLRWFGGM 226 Actinosynnema m...
WP_012919379 156 KALAVTGQVGDGYILQLADPDIAAWMIAAVRRSAEQAGRDPAAIKFCVAAPAYVGH----D-----LEHQRDQTRWFGGM 226 Kribbella flavida
WP_012085973 160 KALQLTGEVADGFILQLADPDIAAWTIRFVREAAERAGRDPGSVKICVAAPAYVTD----Gsq-aaLEHARDQCRWFGGM 234 Kineococcus rad...
WP_009831992 158 KALATAGEVGDGVILQIAEPSLVKWFKDQAINAGEAAGKDMSNFKVQAAAPAYFGK----------MEDCVEHTKWFPAM 227 Marinomonas sp....
WP_012426152 158 IALKCAGEHGDGLILQIADPGLCKWFTDQAVAAGKDVGRDMSKYRVQAAAPAYFGD----------MDECIEATKWFPAM 227 Burkholderia ph...
WP_013156156 231 VGNHVADLVARYGDSSDaVPRELTDYVRARRGYDYSHHGRADNPDTAFVPDGIVDRFCLVGPVEEHVEKLERLREAGVDQ 310 Nocardiopsis da...
WP_009773437 227 VGNHVADIVKKYGADGD-VPKALTDYIKEREGYDYNEHGQAGNTHAAFVPDEIVDRFCIMGTAEQHIEKLEKLRALGVDQ 305 marine actinoba...
WP_009942325 227 VGNHVADIVARYGDSAQaVPAALTDYVKGRHGYDYSHHGRAGNPSTDFVPDEIVDRFCLLGPWEAHVAKLHELADAGVDQ 306 Saccharopolyspo...
WP_012378399 227 VGNHVADLVARYGEHSGlVPEALTAYIAGRSGYDYSHHGRAGNPDTAFVPDEIVDRFCLLGPAEAHIEKLRALRDMGVDQ 306 Streptomyces gr...
WP_013116665 232 VGNHVADIVRRYGTDSA-IPKALTDYVRDREGYDYNEHGRAGNSHTTFVPDEIVERFCLLGSPHEHVEKLRELEALGCDQ 310 Cellulomonas fl...
WP_003895005 227 VGNHVADIVARYG-SSGaVPQALTEYIKGRVGYDYNEHGRAGNSHADFVPDEIVDRFCILGPAPAHISKLQELQKLGVDQ 305 Mycobacterium s...
WP_011563219 227 VGNHVADLVARYGEGSE-IPTALTDYIKARREYDYSHHGKAGNPTTDFVPDDIVDRFCVLGDARDHIVKLRALEKLGVDQ 305 Rubrobacter xyl...
WP_011729474 227 VGNHVADLVDRYGGDGTqVPAALTDYIRDRQGYDYNEHGRAGNAHTEFVPDEIVDRFCVLGPAEDHVRRLRELADLGVDQ 306 Mycobacterium s...
WP_015800932 227 VGNHVADLVARYG-DSGaVPRALTDYIAGREGYDYAHHGRAGNRSADFVPDSIVDRFCLVGPASAHVERLRELAELGVDQ 305 Actinosynnema m...
WP_012919379 227 VGNHVADIVARYGTTGG-IPQALTDYIKDRQGYDYAEHGRAGNSHTAFVPDEVIDRFCVLGPVENHLARLAELTAIGVDQ 305 Kribbella flavida
WP_012085973 235 VGNHVADIVERYGATGE-VPAALTGYIAGRRGYDYNEHGRAGNTHADFVPDEIVDRFCVIGTAEQHRERMRALQDLGVDQ 313 Kineococcus rad...
WP_009831992 228 VGNHVADIVEKYGADSGlVPKSLTDYIENRKGYDYSKHGQSDNPYLDFISEDIVKSFCVLGEVDDHIAKIRNLEEAGTTQ 307 Marinomonas sp....
WP_012426152 228 VGNHVADIVDKYGKDSHlVPKSLTSYIEKRRGYDYSKHGQSDNPYLDFITPDVVESFCVLGTPDQHIEKIGKLRAAGVTQ 307 Burkholderia ph...
WP_013156156 311 FAVYAMHDDVDGVIEAYGRHVVPAV 335 Nocardiopsis dassonvillei
WP_009773437 306 FAGYLQHDNKEETLRVYGETVIPAF 330 marine actinobacterium PHSC20C1
WP_009942325 307 FAIYAMHDSVDATIETYGDAVISAM 331 Saccharopolyspora erythraea
WP_012378399 307 FALYNMHDAREATIDAYGAEIIPAL 331 Streptomyces griseus
WP_013116665 311 FAVYLQHDNKEETLRLYGERIIPAM 335 Cellulomonas flavigena
WP_003895005 306 FAIYLQHDGQDHTLAEYGRAIIPVI 330 Mycobacterium smegmatis
WP_011563219 306 FNVYLMHDAMEETLEAYGREIIPAL 330 Rubrobacter xylanophilus
WP_011729474 307 FAVYLQHDGKDETLAQYGEAVIPAL 331 Mycobacterium smegmatis
WP_015800932 306 FALYLMHDKKDETMAAYGAEVIPNV 330 Actinosynnema mirum
WP_012919379 306 FALYLQHDAKEETLAAYGRDIIPYV 330 Kribbella flavida
WP_012085973 314 FALYLQHDAKETTMRAYADHVAPGL 338 Kineococcus radiotolerans
WP_009831992 308 FNIYLDNGDEENIIAQYGNHIIPAF 332 Marinomonas sp. MED121
WP_012426152 308 FNIYLDNGDEAQIIETYGDKIIPAF 332 Burkholderia phytofirmans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap