2QVE


Conserved Protein Domain Family
Tyr_2_3_mutase

?
TIGR03832: Tyr_2_3_mutase 
Click on image for an interactive view with Cn3D
tyrosine 2,3-aminomutase
Members of this protein family are tyrosine 2,3-aminomutase. It is variable from member to member as to whether the (R)-beta-Tyr or (S)-beta-Tyr is the preferred product from L-Tyr. This enzyme tends to occur in secondary metabolite biosynthesis systems, as in the production of chondramides in Chondromyces crocatus. This class of enzyme has a prosthetic group, MIO (4-methylideneimidazol-5-one), that forms posttranslationally from an Ala-Ser-Gly motif.
Statistics
?
PSSM-Id: 163544
View PSSM: TIGR03832
Aligned: 5 rows
Threshold Bit Score: 850.312
Threshold Setting Gi: 499834397
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2QVE_A         4 VDGETLTVEAVRRVAEERATVDVPAESIAKAQKSREIFEGIAEQNIPIYGVTTGYGEMIYMQVDKSKEVELQTNLVRSHS 83  Streptomyces gl...
AAL06680      15 VDGETLTVEAVRRVAEERATVDVPAESIAKAQKSREIFEGIAEQNIPIYGVTTGYGEMIYMQVDKSKEVELQTNLVRSHS 94  Streptomyces gl...
WP_028673581  12 FDGENLDVPALRRVAEQRVPCRVPASSLTKAAMSRKLFEDTIRQDVPVYGVTTGYGEMIYMLVAPEHEVELQTNLVRSHS 91  Salinispora are...
ABY66005      14 INGEDMDIDGLRQVAEQRIPCRLTPTVLDKAAKSRAQFETLVTQDVPVYGVTTGYGEMIYMLVDRANEVELQTNLVRSHS 93  Actinomadura ma...
WP_011515131   9 IDGHHLTPDTVAAIARGQRAAIVPEPVLGKVADARARFEQVAAANVPIYGVSTGFGELVHNWVDIEHGRALQENLLRSHC 88  Cupriavidus met...
2QVE_A        84 AGVGPLFAEDEARAIVAARLNTLAKGHSAVRPIILERLAQYLNEGITPAIPEIGSLGX--DLAPLSHVASTLIGEGYVLR 161 Streptomyces gl...
AAL06680      95 AGVGPLFAEDEARAIVAARLNTLAKGHSAVRPIILERLAQYLNEGITPAIPEIGSLGAsgDLAPLSHVASTLIGEGYVLR 174 Streptomyces gl...
WP_028673581  92 AGVGPAFSENEARAIVGARLNALAKGYSAVRPEILERLALYLNLGITPAIPEIGSLGAsgDLAPLAHIASTVIGEGYVLR 171 Salinispora are...
ABY66005      94 AGVGRPFAEDESRAIVAARLNALAKGHSAVRPEILERLALYLNLGITPAIPEIGSLGAsgDLAPLSHLACTLIGEGRILR 173 Actinomadura ma...
WP_011515131  89 AGVGPLFSRDEVRAMMVARANALARGYSAVRPAVIEQLLKYLEAGITPAVPQVGSLGAsgDLAPLSHVAITLIGEGKVLT 168 Cupriavidus met...
2QVE_A       162 -DGRPVETAQVLAERGIEPLELRFKEGLALINGTSGMTGLGSLVVGRALEQAQQAEIVTALLIEAVRGSTSPFLAEGHDI 240 Streptomyces gl...
AAL06680     175 -DGRPVETAQVLAERGIEPLELRFKEGLALINGTSGMTGLGSLVVGRALEQAQQAEIVTALLIEAVRGSTSPFLAEGHDI 253 Streptomyces gl...
WP_028673581 172 -DGRRVRTGDVLREFGIEPLQLRFKEGLALINGTSAMTGLGALVVDQAMIQVRQAEIVAALVIEGLRGSTGPFLPEGHDV 250 Salinispora are...
ABY66005     174 -DGAAVETGPELRRLGIEPLELRFKEGLALINGTSAMTGLGALVVGRAFEQIRQAEICTALVIEALRGSMGPFQPEGHDI 252 Actinomadura ma...
WP_011515131 169 eDGGTAPTAEVLRERGITPLALAYKEGLALINGTSAMTGVSCLLLETLRAQVQQAEIIAALALEGLSASADAFMAHGHDI 248 Cupriavidus met...
2QVE_A       241 ARPHEGQIDTAANMRALMRGSGLTVEHADLRRELQKDKEAGKDVQRSEIYLQKAYSLRAIPQVVGAVRDTLYHARHKLRI 320 Streptomyces gl...
AAL06680     254 ARPHEGQIDTAANMRALMRGSGLTVEHADLRRELQKDKEAGKDVQRSEIYLQKAYSLRAIPQVVGAVRDTLYHARHKLRI 333 Streptomyces gl...
WP_028673581 251 ARPHAGQIDSAANMRTLMQGSRLTVEHAELRRMVQESRSAEDSVQRTNLYMQKAYSLRAVPQVLGGVRDTLTHARTKLDI 330 Salinispora are...
ABY66005     253 ARPHPGQIDSAANMRALLRGSGLTVEHADLRRTVQERKREEESVQRTDIYMQKAYSLRAIPQVLGAVRDTLGRAGETVEV 332 Actinomadura ma...
WP_011515131 249 AKPHPGQIRSAANMRALLADSARLSGHGELSAEMKTRAGEAKNT-GTGVFIQKAYTLRCIPQVLGAVRDTLDHCATVVER 327 Cupriavidus met...
2QVE_A       321 ELNSANDNPLFFEGKEIFHGANFHGQPIAFAMDFVTIALTQLGVLAERQINRVLNRHLSYGLPEFLVSGDPGLHSGFAGA 400 Streptomyces gl...
AAL06680     334 ELNSANDNPLFFEGKEIFHGANFHGQPIAFAMDFVTIALTQLGVLAERQINRVLNRHLSYGLPEFLVSGDPGLHSGFAGA 413 Streptomyces gl...
WP_028673581 331 ELNSANDNPLFFEGREVFHGANFHGQPVAFAMDFVTIALTQLGVLSERRTNRLLNRHLSYGLPEFLVAGDPGLHSGFAGA 410 Salinispora are...
ABY66005     333 ELNSATDNPLFFEGREIFHGANFHGQPVAFSMDFTTIALTQLGVLSERRLNRLLNRHLNYGLPEFLVMGEPGLNSGFAGA 412 Actinomadura ma...
WP_011515131 328 ELNSSNDNPLFFEDGELFHGGNFHGQQVAFAMDFLAIAATQLGVVSERRLNRLLSPHLNNNLPAFLAAANEGLSCGFAGA 407 Cupriavidus met...
2QVE_A       401 QYPATALVAENRTI-GPASTQSVPSNGDNQDVVSMGLISARNARRVLSNNNKILAVEYLAAAQAVDISGRFDGLSPAAKA 479 Streptomyces gl...
AAL06680     414 QYPATALVAENRTI-GPASTQSVPSNGDNQDVVSMGLISARNARRVLSNNNKILAVEYLAAAQAVDISGRFDGLSPAAKA 492 Streptomyces gl...
WP_028673581 411 QYPATALVAENRTI-GPASAQSIPSNGDNQDIVSMGLIAARNARRVLTNNDQILAVELLAAAQAVDLADRSAGLSRAARA 489 Salinispora are...
ABY66005     413 QYPATALVAENRTI-GPASTQSIPSNGDNQDIVSMGLIGARNARRVLNNNHTILALEFLAAAQAVDVAGRRDGLGPAGAA 491 Actinomadura ma...
WP_011515131 408 QYPATALIAENRTIcSPASIQSVPSNGDNQDVVSMGLIAARNARRILDNNQYILALELLASCQAAELAGAVEQLAPAGRA 487 Cupriavidus met...
2QVE_A       480 TYEAVRRLVPTLGVDRYMADDIELVADAL 508 Streptomyces globisporus
AAL06680     493 TYEAVRRLVPTLGVDRYMADDIELVADAL 521 Streptomyces globisporus
WP_028673581 490 VYDTVRRVVPVLDQDRYMADDIELVADML 518 Salinispora arenicola
ABY66005     492 TYELVRSMAPTLERDRYMADEIEAVADAV 520 Actinomadura madurae
WP_011515131 488 VFAFVRERVPFLSIDRYMTDDIEAMAALL 516 Cupriavidus metallidurans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap