Conserved Protein Domain Family
YokU_near_AblA

?
TIGR03829: YokU_near_AblA 
uncharacterized protein, YokU family
Members of this protein family occur in various species of the genus Bacillus, always next to the gene (kamA or ablA) for lysine 2,3-aminomutase. Members have a pair of CXXC motifs, and share homology to the amino-terminal region of a family of putative transcription factors for which the C-terminal is modeled by pfam01381, a helix-turn-helix domain model. This family, however, is shorter and lacks the helix-turn-helix region. The function of this protein family is unknown, but a regulatory role in compatible solute biosynthesis is suggested by local genome context. [Unknown function, General]
Statistics
?
PSSM-Id: 163541
View PSSM: TIGR03829
Aligned: 4 rows
Threshold Bit Score: 133.058
Threshold Setting Gi: 499200872
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_000995764  2 NCMWCDSTEAKESLNTVYWELPDGTKAIEIQETPCISCSSCGMDYQSDQTVKEIEDQLFLIYTKDLPKQLTYEELMGRPR 81  Bacillus
WP_003182761  3 KCEWCNEEKAAAARTAVYWELPDGTKAIEITDTPAVECEGCGMVYQEDSVTWEIENQLLLIDTKKLPSSVSYDALMKTER 82  Bacillus
WP_012010281  3 TCDWCEENKANAEQTTVYWELITGTQSIEIIETPSISCTHCGMTYQKDETVKEIEDQLILVDQTKLPEKISYEELMSMER 82  Bacillus pumilus
WP_010898412  2 KCRWCEVENPINRTMTTYWELPSGLRAIQLKAVPSIYCSHCHIEEVDETILEELEDQLLLVDESAIPDETTYEQLMKMPR 81  Bacillus halodurans
WP_000995764 82 LLKRNYFDF 90  Bacillus
WP_003182761 83 ILKRNYFDF 91  Bacillus
WP_012010281 83 LLKRNYFDF 91  Bacillus pumilus
WP_010898412 82 RLKRNYFKL 90  Bacillus halodurans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap