Conserved Protein Domain Family
GNAT_ablB

?
TIGR03827: GNAT_ablB 
putative beta-lysine N-acetyltransferase
Members of this protein family are GNAT family acetyltransferases, based on a seed alignment in which every member is associated with a lysine 2,3-aminomutase family protein, usually as the adjacent gene. This family includes AblB, the enzyme beta-lysine acetyltransferase that completes the two-step synthesis of the osmolyte (compatible solute) N-epsilon-acetyl-beta-lysine; all members of the family may have this function. Note that N-epsilon-acetyl-beta-lysine has been observed only in methanogenic archaea (e.g. Methanosarcina) but that this model, paired with TIGR03820, suggests a much broader distribution.
Statistics
?
PSSM-Id: 163539
View PSSM: TIGR03827
Aligned: 18 rows
Threshold Bit Score: 369.271
Threshold Setting Gi: 499200873
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011023872   5 GAELVIDYYNQRIKVMEFTGL-FEALSGNLETLAEAKEMGKIIVYTPPKKGNDVRACGCVEEGIIRGYFSGM-D-C-HIF 80  Methanosarcina ...
WP_011341131   6 DSLIQHGSNSERIYLMKLASRdCPGIVDKLDDLAARHGYTKIFAKVPVSASSFFLNRGYLAEARIPQLYHGQ-EeG-VML 83  Pelobacter carb...
WP_011418708  19 GSVIQHGPYNERIYLLKVGGDaTGLLPFVLVAMAKGYGYSKIFVKVPTGFSKKFSRAGYVEEASIPGLYNGS-NtG-TFM 96  Syntrophus acid...
WP_011832721  12 KSILQHGPFNNRIYFMTLAPDdLPGIIRYADDLAEKEGYTKIVGKVPLSSAEHFFHAGYIIEASIPAFYQGR-EkA-VFM 89  Methanocorpuscu...
WP_010936024 436 TSLIQHGKNSDRIYLMRLAAEeTATLLPEMQSLAAENGYTKLFAKVPGDVKTLFEADGFETEAVIPCFYGGT-K-AgYFM 513 Dehalococcoides...
WP_011843071  11 GTLVQHGRLSDRIYVMHLSPAdLPGILDDLDALAQRERYTKIFVKVPASALPLFIARGYIVEARVPRFFRGReD-G-YFA 88  Methanoculleus ...
WP_011877114  12 SLTTQLDMFNRRIWVQDYKVNdATALRCFLLDLAKKQNLEKIIFPVKEADLPLLQGEEFQLEGVINGYFQGS-N-A-YFL 88  Desulfotomaculu...
WP_014906351  33 TAVLDHDGFNKRIRVVRYDGa-IEKALPDIVAAAKEENAEKIIVYAKQHDEPILAKQLFAPEGYLKGYYLGH-S-A-CVM 108 Bacillus subtilis
WP_011305700  30 RAELVIDYYNSRIKVMNFTGI-FEKISGVLKIVAKVEKIGKIIVYVPLENIKELETCGYVEEGTINGYYAGK-D-C-HVF 105 Methanosarcina ...
WP_003182763  11 TLEADVDLFSKRIRIVNYEGN-VCSFFPDILKEAKKHDIGKIIIFTKTTDRDALLERTFEPEGKIDGYFNGH-D-A-DVF 86  Bacillus
WP_011023872  81 SSYPESSRGISFQKEKEDQILKNCLRKKRetgkrrqkkggsrkmeswrqqKEK---------------------I-C--- 135 Methanosarcina ...
WP_011341131  84 GKFLQPERNIESHADLVKDVLAKAHAKGR---------------------AGR---------------------Q-Netc 120 Pelobacter carb...
WP_011418708  97 GYYLKEQRASEREAATLDAILHLAISRSE---------------------SPV---------------------T-P--- 130 Syntrophus acid...
WP_011832721  90 AKYTNPARREINGSDKQTEMLAAVQNHTA---------------------HRK---------------------DgY--- 124 Methanocorpuscu...
WP_010936024 514 GKFIDEGRKTEENAELLEDVLKVAHSKAG---------------------KAL---------------------SfK--- 548 Dehalococcoides...
WP_011843071  89 AKFFDADRRQESADVAAVI--AAVREKAG---------------------DAR---------------------P-Ag-- 121 Methanoculleus ...
WP_011877114  89 TTYLSEKRCNSSSLLREKQMLEKILGQPR---------------------EYK---------------------L-A--- 122 Desulfotomaculu...
WP_014906351 109 VRYLSESRRQTDSYTEEQEIIEAIYRTAP---------------------RLR---------------------N-D--- 142 Bacillus subtilis
WP_011305700 106 SSYPETSRGISSNKGKEDRIIENCLRKVM---------------------APRrklnkqdgsrknenirkqrknI-G--- 160 Methanosarcina ...
WP_003182763  87 VKYVKEDRRKTADWLMQDQMLAELFSTPR---------------------IAE---------------------I----- 119 Bacillus
WP_011023872 136 --LPEG-YILRLAVQADASAMAALYRQEFQLYPAPLHMENYLLETMDSNVLYLLVER-HGEIVSLASAEMDPEKASAEIT 211 Methanosarcina ...
WP_011341131 121 psLPEG-YVLRSLIESDVEAAAAVYREVFASYPFPIHDPAYLLETMRDHVRYFGVWH-EGRLVALASAEMDRTAGHAEMT 198 Pelobacter carb...
WP_011418708 131 --LDAKrFIIRSCTESDIDQMAAIYRTVFPTYPFPIHDPAYLLDTMRSHVAYFGVES-DGKLVALSSAEMDKSAQNVEMT 207 Syntrophus acid...
WP_011832721 125 --LSEG-FALRPAQTDDADNLAALFQRVFPTYPFPIFDPEYLKKSMQDNVRYFLIMH-GEKITAAAACEVDEVSLTAEMT 200 Methanocorpuscu...
WP_010936024 549 --LPRG-YTLRKCTADDTAAMAEVFSTVFASYPFPIYEPEYISRTMTESITYYGIWH-GQKLAALASAEQYPLEGHVELT 624 Dehalococcoides...
WP_011843071 122 --LPPG-WKYAPGSEDDADDLAALYGEVFATYPFPIADPGYLRETMAGDYRYFTVRTaDGRLAAASSAEIYREDENVEMT 198 Methanoculleus ...
WP_011877114 123 --LPKK-YSLEIATSRHAKKMAELFKIVFKSYPTPVYDPKYLNEAIQKGDLYLVCCD-GDTLAGVATAEIDWKQNHAELT 198 Desulfotomaculu...
WP_014906351 143 --STPV-FTMRKAETNDMYQLSMLYKKVFRTYPTPVFDPAYIEKTMNANTVYYIMLD-HDRLISAASAEINPELGHAEIT 218 Bacillus subtilis
WP_011305700 161 --LPEE-YRLKPAVQADASAMATLYRQEFKFYPTPLHMKSYLLKTMDSNVLYFLVEK-QGTILSLASAEMDLTNKCAEIT 236 Methanosarcina ...
WP_003182763 120 --QNAS-FKIRRAVSVDAPVLADLYNSVFPVYPAPVSDSAYLKEAMGKGAVYYLAFD-GEKVIASAGADVNPALGNAEIT 195 Bacillus
WP_011023872 212 DCLTVPSERGKGLMKELIKALEEELSERNFLSSYTLCRASSPGINSAFASLGYACTGRLVNNCRIGKGFENMNIWGKLL 290 Methanosarcina a...
WP_011341131 199 DFATLPSCRGNGFAQALLAFMEQEIKGDGIRTAFTIARAYSYGMNITFARAGYRFGGTLRNNTQICGRLESMNVWYKPL 277 Pelobacter carbi...
WP_011418708 208 DFATLLQWQRSSLSLHLLARMEKEMKQEGIKTAYTIARAMSPGINVTFSRLGYAYGGRLKNNTNISAQIESMNVWYKKL 286 Syntrophus acidi...
WP_011832721 201 DFAADPLYRGRGFAGILLSEMEKAMKREGIITGYTIARSISLPMNAVFAGAGYRFGGMLPNNTSISGAIESMNIWYKKL 279 Methanocorpuscul...
WP_010936024 625 DFATLPDYRRRKLAGILLHTMETEMKQKGFGVSYTSAVAESYGMNISFARQGYEFAGRLKNNTQINGGLKSMNIWYKCL 703 Dehalococcoides ...
WP_011843071 199 DFAVHPDFRGQNLSGLLLSRMEGEMRAAGMKTAFTIARALSYPINATFARAGYAWGGTLVNNTNICGGFESMNVWYRPL 277 Methanoculleus m...
WP_011877114 199 NCATHPDYRGLGLNTILLKRLEESCLAKGINCLYSLARASSYGINLILHRLGYDSQGTLINNCHIAGDFENMNIWVKPa 277 Desulfotomaculum...
WP_014906351 219 DCAVLPEYRGHSLTSFLIEALEKEMAGEDIVHVFSLARASSFGMNAVLYHSGYQYGGRLINNCFIAEGLENMNIWCKQL 297 Bacillus subtilis
WP_011305700 237 DCLTIPSERGKGLIKELIKALEKELSNRGFKSSYTLCRASSPGINTAFASLGYAYTGRLVNNCKIGNGFEDMNIWCKIL 315 Methanosarcina b...
WP_003182763 196 DCAVLPEYRGFSLTRRLIAELETDLKQSGIFCVFSIARAASFGMNASLYHLSYSYRGRLLNNCLIYRSIENMNIWCKNL 274 Bacillus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap