Conserved Protein Domain Family
YvyF

?
TIGR03826: YvyF 
flagellar operon protein TIGR03826
This gene is found in flagellar operons of Bacillus-related organisms. Its function has not been determined and an official gene symbol has not been assigned, although the gene is designated yvyF in B. subtilus. A tentative assignment as a regulator is suggested in the NCBI record GI:16080597.
Statistics
?
PSSM-Id: 163538
View PSSM: TIGR03826
Aligned: 10 rows
Threshold Bit Score: 155.619
Threshold Setting Gi: 499958916
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_012011429   2 NQLANCPQCNQLFLKTtIQTVCNKCFEEEERSFDIVYKFLRKQSNRQSTIAEIVDATEVDEELILKFIRLKRLQISQFP- 80  Bacillus pumilus
WP_003185715   2 SQLANCPRCNALFMKSsFQTVCASCLKEEERAYEIVYKFLKKQENRQSTMFQIVEKTGVEEELILKFIRQKRIQISNFP- 80  Bacillus
WP_003227995   2 GELANCPKCNALFLKTkLQTVCQACIKEEEKSFETVYKFLRKQENRQSTLSRITEETGVEEELILKFIRQKRIQITHLP- 80  Bacillales
WP_011066903   2 GELANCVRCDTVYVKT-TRDICMSCFQKEEKAFQKVYAFLRVRQNRQATLSEIVDATEVKETLITKFIKERRLQVKNFP- 79  Oceanobacillus ...
WP_011888210   2 AELANCTKCGRLFVRMsTRDVCESCYQEEERQFERVYTFLRKRENRTATMAQIVEATGVAEKLITKWIREGRLQLVRFP- 80  Geobacillus the...
WP_010899752   3 NNLANCPVCGELFVKA-LRPICNKCFRKREENYEKVSTFLRKKSNRMATVTEVYEKTGVSIQDIEQFIREGRIQLKQFP- 80  Bacillus halodu...
WP_011247924   2 AELANCQKCGAVFVKN-IHSICRSCYEEEERCFQKVNQFLRKRENRSATKQEVVDGTGVSYDMVQTLIRKGRLQLRHFP- 79  Bacillus clausii
WP_012061992   1 MDLRNCKQCGRAFSYQ-GMEVCSRCASDDQSEFAKVKEYLYEHPG--ATVSEVSDETEVSEKSILRYLRESRIEIRESD- 76  Alkaliphilus me...
WP_011024921   4 MEIRNCKRCGRPYIYT-GKDLCPVCYQQDEEDFLKVRDYLDLHPN--ATMLEISQNTQVSAKKIMDFLKEGRLILSPSNv 80  Caldanaerobacte...
WP_011639650   2 SNLRNCSKCGRVFPYM-GRNICPRCLEKEEDEYQVVRRYVRDHPG--AGVIEVVEETGVEEDKILQFLRDGRLQAKGL-- 76  Syntrophomonas ...
WP_012011429  81 NINYPCERCGQPIRKNKLCSQCEQDIQSQISQMNQEEERKR-----EI-ES----RKKDTYYAINPKND 139 Bacillus pumilus
WP_003185715  81 NLGYPCERCGTLIREGRYCMSCEQDLASQMSQLDQLEQLER-----ER-NN----SSKGTYYTFKPKND 139 Bacillus
WP_003227995  81 NLAYPCERCGTSIREGKFCKACQSDIKDQMDHLNHEDALKI-----EK-EN----SKKDTYYAYNTKNS 139 Bacillales
WP_011066903  80 NLGYPCENCFTVISSGKLCDNCIGKFKEDLSAYEQMEERNS-----KK-EK-----KVDTFYAIDKHGK 137 Oceanobacillus iheyensis
WP_011888210  81 NLTYPCESCGTMIREGRLCANCLGKLQKDLRQMEERK---D-----QN-AR----SRYITYYIQEQEDK 136 Geobacillus thermodenitrif...
WP_010899752  81 NLGYPCESCGATIREGRLCHGCADNLKAGLDAGEKEKQFQQrkqanEK-AK----EKNLTYHSLQDRLK 144 Bacillus halodurans
WP_011247924  80 NLYNICERCKQRTKEPWICHSCREEMKRDLANSEQQSKPAK-----RI-DG----EQRSSYRLQETLHK 138 Bacillus clausii
WP_012061992  77 NLYLDCERCGAGIQSGKYCDSCAGEMKRQFTAAITPKTKPK-----EEtTT----ESKNRMFIAERKRQ 136 Alkaliphilus metalliredigens
WP_011024921  81 NIGLKCERCGKPILSGRFCDECKLELAKELTKGYESKTTKD-----ED-ET-----KGERLYVYDTKKK 138 Caldanaerobacter subterraneus
WP_011639650  77 TASLRCERCGQSINSGRFCESCINEVNAEIQGHLPQKAKSE-----EP-KRpprgKVKDKMHIKDRGFF 139 Syntrophomonas wolfei
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap