Conserved Protein Domain Family
FliZ

?
TIGR03823: FliZ 
flagellar regulatory protein FliZ
FliZ is involved in the regulation of flagellar assembly and possibly also the down-regulation of the motile phenotype. FliZ interacts with the flagellar translational activator FlhCD complex.
Statistics
?
PSSM-Id: 163535
View PSSM: TIGR03823
Aligned: 4 rows
Threshold Bit Score: 293.655
Threshold Setting Gi: 499405850
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011093317   1 MHPSIRKKQLLSRYLKDFKHRQTNCSQCDKELDRVSLVFRNQLINKKSIGSIDRLIDDEIWSGLQKELIPLCRFCSEILC 80  Pectobacterium ...
WP_005160338   1 MPGLQLKKRPLSRYLKDYKHGQTHCSHCHKQLDRMALVFRGQIINKEAIAGMDQPIDDQVWSKLQHELTALCRFCSEIYC 80  Yersinia entero...
WP_015834742  17 MSVTTQKKRPLSRYIKDYKHSQTHCLHCHKALDRISLVFNGQVINKESISEMTELIDDKTWDELQDKFVALCRFCSEIYC 96  Photorhabdus as...
WP_021537300   1 MMVQHLKRRPLSRYLKDFKHSQTHCAHCRKLLDRITLVRDGKIVNKIEISRLDTLLDENGWQVEQQSWAALCRFCGDLHC 80  Escherichia coli
WP_011093317  81 NTTASYFDIKAFTQYLIEQTEVRHSTMREYVIRLRRLDELLVANNYPAETFSGhrGGVQQRVCDYLPDIEQNIYRSALRK 160 Pectobacterium ...
WP_005160338  81 NSTPGYFDIMAFKQYLFEQTEMSHSTVREYVVRLRRLDEMLVATNYPAEKFAS--ETMHQRIIDELPNAAHNNYRIALRK 158 Yersinia entero...
WP_015834742  97 NSETDYFDIMSFKQYLFEQTEMSHSTVREYVVRLRRLDELLTSSNYPVKEFTT--EKIQEKLSEKLSQSAFSNYNIALRK 174 Photorhabdus as...
WP_021537300  81 KTQSDFFDIIGFKKFLFEQTEMSPGTVREYVVRLRRLGNHLHEQNISLDQLQD--GFLDEILAPWLPSTSTNNYRIALRK 158 Escherichia coli
WP_011093317 161 YDQYLDWQRH 170 Pectobacterium atrosepticum
WP_005160338 159 YDQYLAWQKN 168 Yersinia enterocolitica
WP_015834742 175 YEQYLSWQQG 184 Photorhabdus asymbiotica
WP_021537300 159 YQHYQRQTCT 168 Escherichia coli
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap