Conserved Protein Domain Family
AblA_like_2

?
TIGR03822: AblA_like_2 
lysine-2,3-aminomutase-related protein
Members of this protein form a distinctive clade, homologous to lysine-2,3-aminomutase (of Bacillus, Clostridium, and methanogenic archaea) and likely similar in function. Members of this family are found in Rhodopseudomonas, Caulobacter crescentus, Bradyrhizobium, etc.
Statistics
?
PSSM-Id: 163534
View PSSM: TIGR03822
Aligned: 8 rows
Threshold Bit Score: 493.89
Threshold Setting Gi: 500986421
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011648110   6 YRHAGELLTAGIISADQLPVVSRVAENYVIALPARLATLIDRDDPLDPIGLQYVPSGEELNAQPGEMDDPIGDAAHSPIP 85  Hyphomonas nept...
WP_010972398  16 IKTPEALLEAGLIEAEALEGLRAVTQRYALAITPAVTGLMDSHDPQDPIARQFVPDLAELVHLPEERDDPIGDDAHSPVH 95  Agrobacterium f...
WP_011427228   7 IKSVDDLVEAGLATPADRAALEAVTARYAITLTPEITRLIDRADPNDPIARQFVPDAAELVVAPEERADPIGDHAHSPVE 86  Rhizobium etli
WP_010968467   7 IRTARELADAGLVGREQEEAISRVASRYAVAISPTIARLVDRDDPNDPIARQFVPDMAELTLMPEERADPIGDGAHSPVA 86  Sinorhizobium m...
WP_010918602   7 LRDARSLTEAGLVPSERLPALEAVAARYAVAITPAMAELIDPDRDDDPIARQFVPSPEELVSSPGEDGDPIGDAAHSPVE 86  Caulobacter vib...
WP_011314901  13 LRRPEDLIAHGLAPAAALADLEKVAARYAIAITPEVANLIDPADPDDPIARQYLPSADELAAQAYERADPIGDHARSPVD 92  Nitrobacter win...
WP_011631794  27 LRSLADLRRAGLI--DDEAPLQAVAAQYAIAIPPAMQALIT--DRHDPIGLQVIPDPAEMITAPYENVDPIGDDALSPVP 102 Granulibacter b...
WP_012040010   6 LRTADQLIEAGLAPPAARAGLEAVAARYATAIPAPLAALIG--DPADPIGLQFIPDPAELETAPHERADPIGDDALSPVP 83  Acidiphilium cr...
WP_011648110  86 GIVHRYPDRVLLKITSTCPVYCRFCFRRERVGPEKGDALSKAEIDAACAYIADRPEIFEVILTGGDPMILSPARAGALTR 165 Hyphomonas nept...
WP_010972398  96 GIVHRYPDRVLLKAVHVCPVYCRFCFRREMVGPQGNGMMSPEELDAAFAYIKENPAIWEVILTGGDPLVLSPRRLSDLMK 175 Agrobacterium f...
WP_011427228  87 GIVHRYPDRVLLKAVHICPVYCRFCFRREMVGPQGLGTLDAAAMEAAFDYIGSHQEIWEVILTGGDPLVLSPRRLREIMK 166 Rhizobium etli
WP_010968467  87 GIVHRYPDRVLLKAVHVCPVYCRFCFRREMVGPEGLGTLTPAELDAALAYIAGRPEIWEVILTGGDPLVLSPRRLGDIMV 166 Sinorhizobium m...
WP_010918602  87 GIVHRYPDRVLLKPTHTCAVYCRFCFRREMVGPEGLSNLTPAQLDAAFAYIAQRPQIWEVIVTGGDPLVLSPRRLADLMD 166 Caulobacter vib...
WP_011314901  93 GIVHRYPDRVLLKLVHVCAVYCRFCFRREMVGPAKETALSKSATAAALDYIRSHPEVWEVILTGGDPLMLSPRRLAEIMA 172 Nitrobacter win...
WP_011631794 103 GIVHRYPDRALLKPLLICPVYCRFCFRREHVGPDG-GVLSEEQLRIALDWLAGHPQIREVILTGGDPLMLSPRRLSFIIN 181 Granulibacter b...
WP_012040010  84 GIVHRYPDRALLKPTLACPVYCRFCFRREHVGPEG-GVLSEAELEAAFRWLADHDAVSEVILTGGDPLILSPRRLGAIFA 162 Acidiphilium cr...
WP_011648110 166 RLEAIDHVKVIRWHSRVPVAAPERVTPEFTEAIRSSEKAVFVAVHANHAREFTPEAVAAIRRLSQAGISLVSQSVLLRGV 245 Hyphomonas nept...
WP_010972398 176 RLRDIPHVKIVRFHTRVPVVDPDRIDAPLIEALKASGKTTYVALHANHARELGDAARNACARLIDAGIAMVSQTVLLKGI 255 Agrobacterium f...
WP_011427228 167 ALANISHVKIVRFHTRVPVVDPEKIDAALIAALKASGKTVYVALHANHPRELTMEARAACARLVDAGIVMVSQSVLLKGI 246 Rhizobium etli
WP_010968467 167 RLAEIDHVKVVRFHTRVPVVEPDRVDAGLIAALKSSGKATYVALHANHPRELTAEARAAAARLIDAGIVMVSQSVLLKGV 246 Sinorhizobium m...
WP_010918602 167 RLEAIDHVKIVRFHTRVPAVDPGAVTPELVAALKRSSKTVYVALHANHARELTPAARAACAQIVDAGVPMVSQTVLLRGV 246 Caulobacter vib...
WP_011314901 173 ELAAIDHVRIVRIHTRVPVADPARVTDEMAAALRTDGATTWLALHANHPRELTAAARAACARIIDAGIPMVSQSVLLRGV 252 Nitrobacter win...
WP_011631794 182 ELNNIPHIDIIRIHSRVPVADPALVTQAMLDALET-DKAMFLVLHTNNVKELTDLAALSIQSFQRRGIPVLSQTVLLRGV 260 Granulibacter b...
WP_012040010 163 RLRAIPHISRLRLHTRVPLADPARITPALLAALDL-DPPLFLVLHANHAREFGAEARAGLRALRRAGIPLLGQSVLLRGV 241 Acidiphilium cr...
WP_011648110 246 NDTFEALADLMRAFLSVGIKPYYLHQLDAAPGTSHFRVPVEEGQALVRRLRDELSGLATPTYVADIPGGVSKAVMNLPDI 325 Hyphomonas nept...
WP_010972398 256 NDDPAVLADLMRSFVENRIKPYYLHHPDLAPGTSHFRLTIEEGQRIVSALRGHVSGLCQPTYVLDIPGGHGKAMIGRNAA 335 Agrobacterium f...
WP_011427228 247 NDDPAILADLMKAFVENRVKPYYLHHPDLAPGTGHFRLTIEEGQRIVAALRGQISGLCQPTYILDIPGGHGKAVVSGSTV 326 Rhizobium etli
WP_010968467 247 NDDPDVLAALMRAFVETRIKPYYLHHPDLAPGTGHFRLSIEEGQALVASLRGRVSGLCQPAYILDIPGGHGKAVVSAGAI 326 Sinorhizobium m...
WP_010918602 247 NDNPETLVELMRAFVETRIRPYYLHHGDLAPGTAHLRTTVAEGQAIMRALRGTLSGLAQPTYVLDIPGGHGKVPVGPNYL 326 Caulobacter vib...
WP_011314901 253 NDDAATLEALMRAFVQCRIKPYYLHHGDLAPGTAHLRTTLEQGQALMRELRGRVSGLCQPDYVLDIPGGYGKSPVGPGYM 332 Nitrobacter win...
WP_011631794 261 NDSAEALEALYRRILRLRVKPYYLHQLDAAPGTARFRVPVEEGRAILHALRGRISGLAWPTYVIDIPGGYGKVPVDPDYL 340 Granulibacter b...
WP_012040010 242 NDSADTLRALFETMLECGVKPYYLHQLDPAPGTARFHVPIVEGRALIAALRGTISGHALPTYILDSPAG--KTTLEPSPV 319 Acidiphilium cr...
WP_011648110 326 E 326 Hyphomonas neptunium
WP_010972398 336 E 336 Agrobacterium fabrum
WP_011427228 327 Q 327 Rhizobium etli
WP_010968467 327 E 327 Sinorhizobium meliloti
WP_010918602 327 S 327 Caulobacter vibrioides
WP_011314901 333 S 333 Nitrobacter winogradskyi
WP_011631794 341 E 341 Granulibacter bethesdensis
WP_012040010 320 S 320 Acidiphilium cryptum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap