Conserved Protein Domain Family
EFP_modif_epmB

?
TIGR03821: EFP_modif_epmB 
EF-P beta-lysylation protein EpmB
Members of this radical SAM protein subfamily, including yjeK in E. coli, form a distinctive clade, homologous to lysine-2,3-aminomutase of Bacillus, Clostridium, and methanogenic archaea. Members of this family are found in E. coli, Buchnera, Yersinia, etc. The gene symbol is now reassigned as EpmB (Elongation factor P Modification B). [Protein fate, Protein modification and repair]
Statistics
?
PSSM-Id: 163533
View PSSM: TIGR03821
Aligned: 14 rows
Threshold Bit Score: 516.867
Threshold Setting Gi: 499718399
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011520751  15 WLNELADVITNPMELLQQLKLDQdKKLREAIKARQLFPFRVPKTFVKRMKYEDPTDPLLRQVLTLPEEFKQHLDFSKDPI 94  Candidatus Baum...
WP_006233710  16 WLNDLANAISDPFLLLKTLKIDP-TPWEKGLAARKLFALRVPMSFVDRMEIGNPYDPLLRQILPLEPEFEVHDGYSLDPL 94  Photobacterium ...
WP_011507825  35 WQAQLRDAVRDPHELCRRLDLDT-AWLGGAETGHALFPVRVPHAYLARIRPGDPDDPLLRQVLPLDRESEPVAGFVGDPL 113 Chromohalobacte...
WP_011235503  16 WQFELKQAYTQPEELLRALKLDP-ALFSEDIKARKLFAMRVPKPFVAQMQVGDSNDPLLRQVLPLHNEFESEPGYSTDPL 94  Idiomarina loih...
WP_006032529  16 WKKDLASAISDPRKLLFILELPE-VSFQSDFAARQLFPMRVPQSFVDRMEKGNPKDPLFLQVMPKQQEFIQQAGFIKDPL 94  Moritella sp. PE36
WP_015464224  10 WQKELANAIKNPQQLLELLDLNP-EMFALSEPARKNFPMLVPLPFIKKMKKGDINDPLLRQVLPITDEDKQVEGYSIDPL 88  Psychromonas sp...
WP_011589719  42 WQRQQADLITDPAELLAMLDLPV-ESLPDALSAATDFPLRVPRSYVALMERGNPHDPLLRQVLSVADEMVAQPGFSADPL 120 Alcanivorax bor...
WP_002813650  14 WQAALSQAVRNPQELLELTGLDN-HPQIASEATRRQFPLRVPRSYIARMKKGDPNDPLFRQVFPLHAEDQISPGFNTDPV 92  Nitrosococcus o...
WP_011467563  14 WQEELSSLITDPAELLERLELPE-SLLESAQKANKLFPLRVTQSYASRIKPGDVDDPLLRQVLPLGAELTSPASYTADPL 92  Saccharophagus ...
WP_011814766  21 wrQELIGAIRQPEELLRRLDLPE-SLLAPAEQAARTFPMRVPVPYLARIRPGDPNDPLLRQVLPIGAELETHPGYTADPL 99  Halorhodospira ...
WP_011520751  95 NEQQyNVAPMLLHKYYNRAILLVKSGCAINCRYCFRRYFPYQDNQSNQANWKLAIEYIKQHSELNEIILSGGDPLMAKDH 174 Candidatus Baum...
WP_006233710  95 EEQD-NAIPGLLHKYKNRALMIVKGGCAVNCRYCFRRHFPYNDNKGGKAQWKVALTYIAEHPELNEVILSGGDPLMAKDH 173 Photobacterium ...
WP_011507825 114 EEAEhRPRPGLIHKYRNRVLLIASPACAINCRYCFRRHFPYAENSPSRGQWETTLDYLRQDTSINEAIFSGGDPLASPDR 193 Chromohalobacte...
WP_011235503  95 QEQQg-PVNGLLHKYKSRVLLILQGGCAVNCRYCFRRHFPYDELTFSKRQLTETLEYIRQHPEINEVILSGGDPLMAKDE 173 Idiomarina loih...
WP_006032529  95 DEHEa-VVPGLLHKYTNRVLFIVRGGCAINCRYCFRRHFPYQDNSNNKHEWQQAIDYIRAKPEIIEVIFSGGDPLMANDE 173 Moritella sp. PE36
WP_015464224  89 LEHD-NSIQGVLHKYKSRILLVLKSGCAVNCRYCFRRHFPYQDNNLNKKQLAEVILYLKAHPDVNEVILSGGDPLMSKDD 167 Psychromonas sp...
WP_011589719 121 DEAEhTAVPGLLHKYHGRALLVVTGACAVHCRYCFRRHFPYQTHLSGKR-WKQALEWLAARPDINEVILSGGDPLTLSNQ 199 Alcanivorax bor...
WP_002813650  93 GDLAaMPAPGVLQKYTGRVLLVATGACAIHCRYCFRRHFPYGDHNPAQEHWKRALQYIAQNQSIREVILSGGDPLTLADN 172 Nitrosococcus o...
WP_011467563  93 AEQSfNPAPGVIHKYHGRVLLISASQCAINCRYCFRRHFDYQTNTPSRAEWQEALRYIADNESIDEVILSGGDPLAVSDR 172 Saccharophagus ...
WP_011814766 100 AEQGaRTGSGVLQKYNGRSLLIATGGCAIHCRYCFRRCFPYNR----EAGWRTALDQLEQHGAPEEVILSGGDPLLLDDQ 175 Halorhodospira ...
WP_011520751 175 ELDKLLNLLEDIPHLTKLRIHSRLLIVIPARITSFICQRLARSRLKVVLVTHINHAQEIDSSVQKSIAKLRNKQVTLLNQ 254 Candidatus Baum...
WP_006233710 174 ELAWLVDEIESISHIKRLRIHTRLPVVIPNRITDELCTLIGNSRLQTILVTHINHANEINDELTDAMTKLKRVNATLLNQ 253 Photobacterium ...
WP_011507825 194 RLAWLAERLADIPHLKRLRLHTRLPVVIPDRVDSPLLDWLAATRLQTVMVVHINHPNEIDAGVADAMQRLRGAGVTLLNQ 273 Chromohalobacte...
WP_011235503 174 RLKGLINEFELLPQLTRLRIHSRLPVVIPSRLTHKLKEVLSNSRLQSVLVLHANHANEISPELAGALDDWHHAGIHLLNQ 253 Idiomarina loih...
WP_006032529 174 QLGWLVAQLEQIPHLKRLRIHTRLPVVMPTRVTDELVTLLKQSSLRCSVVLHINHPNELAAELPAALAKFTTAGISLYNQ 253 Moritella sp. PE36
WP_015464224 168 FLDYVINELQQLKQLKRLRIHTRLPVVIPQRVTDRLCEILKATRLQVVFVVHINHAHEIDKAFKIAMLKLHHAGIQLLNQ 247 Psychromonas sp...
WP_011589719 200 RLEQLLDALESIPHLRRLRIHSRTPVVIPERLEVGLKALLTWRRWQTVLVLHGNHPREISPALVERCRDLRSAGITLLNQ 279 Alcanivorax bor...
WP_002813650 173 RLAELAQTLATISHVKRLRIHTRLPVVLPERVDHHLLQWLEGTSLQKVVVIHANHVNELDDRVAAALNDLSRAGCRLFNQ 252 Nitrosococcus o...
WP_011467563 173 QMQWLVNQIAVIPHVTRLRIHTRLPVVLPNRITSELVDTLVKTRLQCVIVVHINHAAEIDEHVHNRLKILKKANITLLNQ 252 Saccharophagus ...
WP_011814766 176 ALGACLERLGRIAAVRRVRIHTRLPVVIPSRVTAALARHLGQIRLQSVIVVHANHPREIDAEVSSALARLRNVCSTVLNQ 255 Halorhodospira ...
WP_011520751 255 SVLLRGINDNAQILATLSETLFSIGILPYYLHTLDCVQGATHFIVDDQRARKIMHDLLSKVAGYLVPRLVRDISGMPSKT 334 Candidatus Baum...
WP_006233710 254 GVLLRGINDSVDALTSLSEALFTAGIQPYYLHVLDKVQGATHFMVDDTEARQLMAGLMQNVSGYMVPKLTREIGGRASKT 333 Photobacterium ...
WP_011507825 274 SVLLRGVNDDVETLARLSERLFEVGILPYYLHVLDPVEGAAHFDVPDAEAVSLVETLRTQLAGFLMPRLVREVPGEASKT 353 Chromohalobacte...
WP_011235503 254 SVLLSGVNDNLTALIELSEKLFSARVMPYYLHQLDKVEGASHFAVSDEKAQALWQKMTHELPGFLVPRLVREEAGELSKT 333 Idiomarina loih...
WP_006032529 254 AVLLADINDNADDLVELHERLFDNRIQPYYLHLLDKVEGASHFDVPEEKAVAIMNELLLRLPGFLVPKLVREIGGEKSKT 333 Moritella sp. PE36
WP_015464224 248 SVLLRGVNDNAEALVALSEALFDAHILPYYLFLLDKVQGAQHFDLEEQKAKALLLEISAALPGYLVPRLSREIAGEKSKT 327 Psychromonas sp...
WP_011589719 280 SVLLAGVNDRADTLAELSDRLFDAGVMPYYLHQLDAVQGAAHFAVSDEAAREIHAALRARLPGFLVPRLTREEPGEPAKT 359 Alcanivorax bor...
WP_002813650 253 TVLLRGINDKVSALSDLSEGLFDTGVLPYYLHLLDKVQGAAHFEVDIITAQRLHRTLRARLPGYLVPLLVQEQAGAPSKL 332 Nitrosococcus o...
WP_011467563 253 SVLLKGVNDSASCLVSLSKRLFSCGILPYYLHLLDKVTGAAHFDVDEASAIALHNHLLATLPGYLVPKLVREVPNAASKT 332 Saccharophagus ...
WP_011814766 256 TVLLRGVNDDTATLASLSERLFAADVLPYYLHLLDPVAGAAHFDVDAKTGQRLWAELARSLPGYLVPRLAREEPGAAAKT 335 Halorhodospira ...
WP_011520751 335 IL 336 Candidatus Baumannia cicadellinicola
WP_006233710 334 PL 335 Photobacterium profundum
WP_011507825 354 PL 355 Chromohalobacter salexigens
WP_011235503 334 AI 335 Idiomarina loihiensis
WP_006032529 334 PI 335 Moritella sp. PE36
WP_015464224 328 LI 329 Psychromonas sp. CNPT3
WP_011589719 360 VL 361 Alcanivorax borkumensis
WP_002813650 333 PR 334 Nitrosococcus oceani
WP_011467563 333 AV 334 Saccharophagus degradans
WP_011814766 336 VI 337 Halorhodospira halophila
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap