Conserved Protein Domain Family
lys_2_3_AblA

?
TIGR03820: lys_2_3_AblA 
lysine-2,3-aminomutase
This model describes lysine-2,3-aminomutase as found along with beta-lysine acetyltransferase in a two-enzyme pathway for making the compatible solute N-epsilon-acetyl-beta-lysine. This compatible solute, or osmolyte, is known to protect a number of methanogenic archaea against salt stress. The trusted cutoff distinguishes a tight clade with essentially full-length homology from additional homologs that are shorter or highly diverged in the C-terminal region. All members of this family have the radical SAM motif CXXXCXXC, while some but not all have a second copy of the motif in the C-terminal region.
Statistics
?
PSSM-Id: 163532
View PSSM: TIGR03820
Aligned: 12 rows
Threshold Bit Score: 752.684
Threshold Setting Gi: 499200871
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011843070  18 GAAAEVWRDWRWHVRHAITEISTFERLLGVSFGKDERRELEETASRFPLRITPYYLSLIDAKDLWNDPIFMQCFPSPAEL 97  Methanoculleus ...
WP_011498441  18 DDFLDKWKDWNWQLKHSIRDIETFERLLGINFEPPEKEKLKETLEKFPLSITPYYLSLIDSDDFRNDPIFLQSFPSPEEL 97  Methanococcoide...
WP_011418707  69 GSSVRNWKDWKWQLRHCIKDLDTFETLLDIRLPETLRRQFKLIVEKFPMSITPYYLSLIDTEDLENDPVFKQSFPAINEL 148 Syntrophus acid...
WP_011189400  19 KINISKWMDWKWQLRNSIKSVEQFESLLGIEMDEKYRKKIKETLRKFPLSITPYYLSLINSEDYSNDPIFIQSFPSPKEL 98  Desulfotalea ps...
WP_011358302  17 NATLSDWQDWKWQMRHSVRTLSAFESLLGITLSDEQRKAFGQTVAKFPMSITPYYLSLINTRDMANDPVFLQSVPSPREL 96  Pelodictyon lut...
WP_011366350  18 STSTSGWEDWKWHVRNSIRTVEAAEKILGVTFSDEKRALYKRTLDKFPMSITPYYFSLIDQEDYESDPVFMQAFPDIREL 97  Desulfovibrio a...
WP_011832722  32 iDDGEYWKNWKWQVRHAVRSIDMVQQVLGITFDPKEREELQRTVEKFPISITPYYLSLIDTEDYRNDPIFRQAFPSPAEL 111 Methanocorpuscu...
WP_010936024   8 DYSEEEWGNWKWHVSHTIKDLATVEKLLGVKFSVEKRRSLEDTIRNFPMSITPYYFSLIDPKNFENDPVFIQSVPSAAEL 87  Dehalococcoides...
WP_011972962  19 NIGLEEWYDWKWQLKNSIRDIDTFEEVIGIKFHEDEKAELQEAADVFPLSITPYYASLIDVKNFREDPIFKQSFVGVEEL 98  Methanococcus a...
WP_011170805  19 NATIDNWNDYKWQLSNSIKDVDTLENFLGITFDEKEKTEIQKAIDVFPMSITPYYASLIDIKNLGKDPIYKQSVASSKEL 98  Methanococcus m...
WP_011023873  10 NAGEIEFSDWKWQYRNRITTVEELEKL--IPLSDPEKADIKKALEVFSMAISPYYASLIDPEDPKC-PIRMQAVPLSAEL 86  Methanosarcina ...
WP_010898411  19 DVTESQWNDWLWQLTHTIRTIDDLKQV--INLTEEEEEGVRISTKTIPLNITPYYASLMNPDDPRC-PIRMQSVPISKEI 95  Bacillus halodu...
WP_011843070  98 QVEPDDMEDPLAEDADHPA--PCITHRYPDRVLFLVSNVCAMYCRHCTRKRKVGDVDSIPSEAEVIESLDYIRENPGIRD 175 Methanoculleus ...
WP_011498441  98 IISADELEDPLSEDTDSPV--EGITHRYPDRVLFHISNVCSMYCRHCTRKRKVGDIDYIPEKEKILEGIEYIRNTPQIRD 175 Methanococcoide...
WP_011418707 149 DVQSTDMSDPLHEDRDSPV--PGLTHRYPDRVLLLISNTCAMYCRHCTRKRRVGDRDTIPSREQIMKGIEYIRDTPQVRD 226 Syntrophus acid...
WP_011189400  99 DISPHDMEDPLAEDKDSPV--PNITHRYPDRVLLQVSNTCAMYCRHCTRKRKVGDVDSIPLKQEILNGIEYIRQTPVIRD 176 Desulfotalea ps...
WP_011358302  97 EIMTGDMADPLHEDADSPA--PCVTHRYPDRVLLLVSNTCPMYCRHCTRKRKVGDRDTIPGRSAISEGIDYIRRTPQVRD 174 Pelodictyon lut...
WP_011366350  98 NVSPHDMADPLHEDEDSPA--PGITHRYPDRVLFHVSNLCSMYCRHCTRKRKVGDRDSVPDRGQLKQGIEYIRRTPAIRD 175 Desulfovibrio a...
WP_011832722 112 IVENYELSDPLAEDKDSPC--ECITHRYPDRVLFLVSNTCAMYCRHCTRKRKVGDKDSIPDREKILEGIAYIRENTQIRD 189 Methanocorpuscu...
WP_010936024  88 NFSCHDKEDPLAEDVDSPA--PGITHRYPDRVLFHVSNRCAMYCRHCTRKRKVGDVDKTLSRDDLVKGLEYIKNTPQVRD 165 Dehalococcoides...
WP_011972962  99 ITENFEMADPLAEDKDSPV--PGLTHRYPDRILFYISHACAVYCRHCTRKRKVGDTDSIPSKKQIEKGLDYIRNNPQIRD 176 Methanococcus a...
WP_011170805  99 ILENFEMEDPLSEDEDSPV--IGITHRYPDRVLFYINPNCAMYCRHCTRKRKVSEKSSNPSKEEIQKAIDYIKNNNKIRD 176 Methanococcus m...
WP_011023873  87 QKSSWELEDPLCEDLDSPSkeSCITHRYPDRVLFLISNRCGMYCRHCTRKRRVGNREYDYSEKTIREGIEYIREHPEVRD 166 Methanosarcina ...
WP_010898411  96 EKTKYDMEDPLAEDEDSPV--AGLTHRYPDRVLFLVTNQCSMYCRYCTRRRFSGQIGMGVPKKQMDAAIDYIAQTPAVRD 173 Bacillus halodu...
WP_011843070 176 VLLSGGDPFMLPDDRLDWILTELDDIEHVEVVRIGTRTPVVLPYRITEELCAMLARHHPLWVNTHFNHPAEITASSQKAL 255 Methanoculleus ...
WP_011498441 176 VLLSGGDPLMLSDDFLDWILTEINSIPHVEVIRIGSRMPVVLPYRITDELVDVLKKHHPIWLNTHFNHPREMTFSSRQAL 255 Methanococcoide...
WP_011418707 227 VLLSGGDPFLLSTDYLDWILIELKKIEHVEVIRIGTRTPAVLPYRITDELVEMLKKHHPLWINTHFNHPRELTASSRAAL 306 Syntrophus acid...
WP_011189400 177 VLLSGGDPLMLSDDYLDWILSELRTIPHVQVIRIGSRMPVVLPYRVTDSLVAMLKKHHPLWVNTHFNHPREVTASTREAL 256 Desulfotalea ps...
WP_011358302 175 VLLSGGDPFLLSDDYLDWILGELQAIEHVEVIRIGTRTPVVLPQRITPALVAVLKKHQPVWVNTHFNHPREITQSSRNAL 254 Pelodictyon lut...
WP_011366350 176 VLLSGGDPLMLSDERLDWLLGEIRSIPHVEIIRIGSRMPVVLPYRITDGLLAVLKKHHPLWLNTHFNHPRELTRTSRRAL 255 Desulfovibrio a...
WP_011832722 190 VLLSGGDPFMLSDESLDWILTELTAIPHVEVIRIGTRVPVVLPFRITNQLVDILKKHKPIWINTQFNHPKEMTPSAQAAV 269 Methanocorpuscu...
WP_010936024 166 VLLSGGDPLLLSDSMLEWLLSELKAIPHVQVIRIGTRVPVVLPQRITPHLVKIIKKYHPVWVNTHFNHPREITATSIRAL 245 Dehalococcoides...
WP_011972962 177 VLLSGGDPLLLPDDYLDWILTELWSIPHIEVIRIGTRVPVVLPYRITDELVNMLKKHHPLWINTHFNHIKEITKSSKNAL 256 Methanococcus a...
WP_011170805 177 VLLSGGDPLLLSDEFLDWILSEISSIKHVELIRIGSRVPVVLPQRITDNLVNVLKKYHPIWINTHYNHPVEITKESKKAL 256 Methanococcus m...
WP_011023873 167 VLLSGGDALLVSDERLDWLLGELFDIPHVEIVRIGTRAPVTLPQRITPELCEILGKYPSVWLNTHFNHPKEITSEAKKAM 246 Methanosarcina ...
WP_010898411 174 VLLSGGDGLLINDQILEYILKNLRAIPHVEIIRIGTRAPVVFPQRITDHLCSILKKYHPVWLNTHFNTSLEITKEAKEAC 253 Bacillus halodu...
WP_011843070 256 ARLADAGIPLGNQTVLLAGVNDCSRIMKTLVHKLVRNRVRPYYLYQCDLSEGLAHFRTPVSKGIEIIENLIGHTSGFAVP 335 Methanoculleus ...
WP_011498441 256 KKLADAGIPLGNQTVLLAGVNDCQRIIKKLVHKLVQNRVRPYYLYQCDLSEGLSHFRTPIGKGIEIMENLIGHTSGFSVP 335 Methanococcoide...
WP_011418707 307 RKLADAGIPLGNQSVLLSGVNDCPRIMRSLVHKLVANRVRPYYLYQCDLSEGLSHFRTPVGKGIEILESLIGHTSGFCVP 386 Syntrophus acid...
WP_011189400 257 AKLANAGIPLGNQSVLLAGVNDCPRIMKSLVHKLVENRVRPYYLYQCDLAEGLNHFRTPVGKGIEILESLRGHTSGFAVP 336 Desulfotalea ps...
WP_011358302 255 ALLADGGLPLGNQTVLLSGINDCPRIMKALVHKLVRNRVRPYYLYQCDLSEGLSHFRTPVGKGIEILESLIGHTSGFSVP 334 Pelodictyon lut...
WP_011366350 256 ARMADAGIPLGNQSVLLADVNDCPRLFRTLNQKLVQNRVRPYYMYQCDLSEGLSHFRTPVGKGIEIIESLVGHTSGMAVP 335 Desulfovibrio a...
WP_011832722 270 AKLVDAGIPLGNQSVLLARINDCPVIMKELVHQLVKNRIRPYYLYQCDLSEGISHFRTPIAKGIEIMESLIGHTSGFAVP 349 Methanocorpuscu...
WP_010936024 246 RLLADAGIPLGNQTVLLAKVNDCPRVMKALVHKLVENRVRPYYLYQCDPAQGLSHFRTSIGKGIEIIENLIGHTSGFAVP 325 Dehalococcoides...
WP_011972962 257 RKLADVGIPLGNQSVLLRGVNDCPNVIKKLNQKLAANRVRPYYLFQCDLSEGLSHFRTSVRKGVEIIESLIGHTSGFAVP 336 Methanococcus a...
WP_011170805 257 DKLSDSGIPLGNQTVLLAGVNDCPYVMRKLNQKLVSSRVRPYYLYQCDLSKGISHFRTSVSKGLEIIESLIGHTTGFAVP 336 Methanococcus m...
WP_011023873 247 GMLARAGIPLGNQSVLLRGVNDCPMIIKKLCHELLRIKTRPYYLYQCDLSFGLEHFRTSVARGIEIIEMLRGHTSGLAVP 326 Methanosarcina ...
WP_010898411 254 EKLVDAGVPVGNQAVILAGINDSTHIMKKLMHDLVAIRVRPYYVYQCDLSEGISHFRAPISKGIEIMEALRGHTSGYAVP 333 Bacillus halodu...
WP_011843070 336 TYVIDAPGGGGKIPVMPQYLISWSTNRVVLRNFEGVITTYREPDSYEPVWCDRKCATCGQYLRLEGADESKAVGIVKLL- 414 Methanoculleus ...
WP_011498441 336 TYVIDAPHGGGKIPVMPNYIISWSTNRVILRNYEGVITSYKEPESYKQIYCDRNCEKCDLQLKLDDATEYKAIGISKLL- 414 Methanococcoide...
WP_011418707 387 TYVIDAPAGGGKIPVMPNYLISWSTNKVVLRNYEGVITTYKEPDSYEPTFCDRNCKDCNLQLSLEDAGEFRAVGIEKLL- 465 Syntrophus acid...
WP_011189400 337 TYVVDAPGGGGKIPLNPNYLVSFSTNKVILRNYEGVITTYQEPDSYESTFCDRKCADCNLQLYLNDAEESRAIGIEKLL- 415 Desulfotalea ps...
WP_011358302 335 TYVIDAPGGGGKIPVMPNYLISWSTNKVVLRNYEGVITTYKEPDSYLPTFCDRNCDRCDLQLNLDDADAMEAIGIQQLL- 413 Pelodictyon lut...
WP_011366350 336 TYVIDAPGGGGKIPMMPNYAISQGVNKVVLRNYEGVITTYTEPDSYEPSYCDRDCRSCHLTLKEDDADETGAIGIEKLL- 414 Desulfovibrio a...
WP_011832722 350 RYVVDAPGGGGKIPVSPNYLLTWSVNKVVLRNYEGIICTYQEPAVYDRIICDQNCDACKLQLNIRNADESKVVGVAKLL- 428 Methanocorpuscu...
WP_010936024 326 TYVIDAPNGGGKIPIMPNYLISQSSSKVILRNYEGIITAYYQPEDYHPPKCGQDCSACNLELDLNGAAEGSLVGIARLL- 404 Dehalococcoides...
WP_011972962 337 RYVVDAPGGGGKIPVMPNYVISWGTDRVILRNYEGVITTYKEPEHQDD--CSKDCTGCERGLAEEG-EEHDLVGIEKLLf 413 Methanococcus a...
WP_011170805 337 RYVVDAPGGGGKIPVMPNYVVSWGSDRVILRNYEGIITSYVEPSDYGG--CSKNCDTCDR-MCIGD-FEINQTGIEKLI- 411 Methanococcus m...
WP_011023873 327 TFVVDAPGGGGKIPVGPNYLISSSDTGVTLRNYEGVICMYPEPAEYSAA-CPQKCSICDKHPELKS-----DTGLAKLY- 399 Methanosarcina ...
WP_010898411 334 TFVVDAPGGGGKVTLQPNYILSQSPSKTVLRNFEGVISTYPEPDHYVP----GKADDYFAKMT-GITGDERSIGIHRLM- 407 Bacillus halodu...
WP_011843070 415 SDEDPTTALVPEHTERFERR 434 Methanoculleus marisnigri
WP_011498441 415 ADYDDTTSLVPEDNERMERR 434 Methanococcoides burtonii
WP_011418707 466 ADYDDTIALVPRNNDRHRRR 485 Syntrophus aciditrophicus
WP_011189400 416 ADHDRTISLVPKKNERMERR 435 Desulfotalea psychrophila
WP_011358302 414 SDHDATISLIPSSNERLSRR 433 Pelodictyon luteolum
WP_011366350 415 SDWDDTTSLTPENNERLARR 434 Desulfovibrio alaskensis
WP_011832722 429 ADYDDTTTLIPENNERLERR 448 Methanocorpusculum labreanum
WP_010936024 405 SNHEDTDYLVPTECDRMDRR 424 Dehalococcoides mccartyi
WP_011972962 414 NSADDTISLVPQGTERIDKR 433 Methanococcus aeolicus
WP_011170805 412 TDVDNSISLIPENNERVARR 431 Methanococcus maripaludis
WP_011023873 400 DEENDIIALEPEGLERKQRF 419 Methanosarcina acetivorans
WP_010898411 408 --KDEEINLVPKGLKRLELR 425 Bacillus halodurans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap