Conserved Protein Domain Family
put_Glu_GABA_T

?
TIGR03813: put_Glu_GABA_T 
putative glutamate/gamma-aminobutyrate antiporter
Members of this protein family are putative putative glutamate/gamma-aminobutyrate antiporters. Each member of the seed alignment is found adjacent to a glutamate decarboxylase, which converts glutamate (Glu) to gamma-aminobutyrate (GABA). However, the majority belong to genome contexts with a glutaminase (converts Gln to Glu) as well as the decarboxylase that converts Glu to GABA. The specificity of the transporter remains uncertain.
Statistics
?
PSSM-Id: 163525
View PSSM: TIGR03813
Aligned: 4 rows
Threshold Bit Score: 717.755
Threshold Setting Gi: 500902402
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_005174157  16 KKLSIATLAIMNIVAVVSLRGLPAEAEYGLSSIFYYLFAAVFFLIPVSLVAAELATGWPEK-GGVFRWVGEAFGPRLAFL 94  Yersinia entero...
WP_008763557   8 VKLGVFTLAIMNVTAVVSLRGLPAEAVYGMSSAFYYLFAAIVFLIPTSLVAAELAAMFQDKqGGVFRWVGEAYGKKLGFL 87  Bacteroides sp....
WP_025760893  11 KKMTVGTLAIMNITAVVSLRFIPSEAEYGLGAIFYYTFAAIMFLVPVAFVAAELATTYPQK-GGAFRWIGEAFGARWGFV 89  Shigella flexneri
WP_012015567  14 ATITVVGLAMLNIVAVVSLDGPPTEAEYGLSAAFYYLFAAVFFLVPVSLVAAELTTAWPER-GGVFRWAGEAFGARWGFL 92  Salinispora tro...
WP_005174157  95 AMFMLWVEVTVWFPTALTFAAVSLAFIGPEQRWDEALSANKFFVLGIVLFIYWLATFIAFKGVDTFAKVSKWGGIIGTII 174 Yersinia entero...
WP_008763557  88 AIWVQWIESTIWYPTVLTFGAVSIAFIGMNDVHDMSLANNKYYTLVVVLIIYWLATFISLKGMSWVGKVAKIGGMVGTII 167 Bacteroides sp....
WP_025760893  90 GMLMTWLQVIPYFPTVLTFGAVSVAFIDVDMGVAESIASNKWYILFFVLFVYWGAICVALRGVGIFSQVSKWCGIIGTII 169 Shigella flexneri
WP_012015567  93 AIFLLIAQVTIWFPLVLTFAAISLAYTGPEATVDQKLSGNQLYVLVSVLAVYWLATAIAARGVAAFTRVAKWGGIVGTII 172 Salinispora tro...
WP_005174157 175 PAVILIVLGFSYLIGGGTPQ-IELSwEQVVPDFTNFDNVVLAASIFLFYAGMEMNAIHVKDVDNPNRNYPIAIMLSAVGT 253 Yersinia entero...
WP_008763557 168 PAALLIILGIIYLATGGQSN-MDFH-SSFFPDFTNFDNVVLAASIFLFYAGMEMGGIHVKDVENPSKNYPKAVFIGALIT 245 Bacteroides sp....
WP_025760893 170 PAIILVILGFSYLWFSGKPAvIPLGwGDLFPNIANFQNIVLAASIFLAYAGMEMNAVHVNDLDNPTKKYPIAITIASIGT 249 Shigella flexneri
WP_012015567 173 PAAALVTLGIAYLLTGGESQ-IPLRwDDAIPDLSNVSNLALAASIFLFYSGMEMNAVHVQDVRNPDRGYPVAILFAALGT 251 Salinispora tro...
WP_005174157 254 VLIFVLGTLAIAFVIPQSDISLTQSLLVAYDDMFKWAHLEWLGPVVAFALAIGVLAGVVTWVAGPSSGLLVVAKAGYLPR 333 Yersinia entero...
WP_008763557 246 VLIFVLGTFALGVIIPAKDINLTQSLLVGFDNYFRYIHASWLSPIIAIALAFGVLAGVLTWVAGPSKGIFAVGKAGYMPP 325 Bacteroides sp....
WP_025760893 250 IAIFLLSTLGVAFIIPTDKISLTQSLLVAYDMLFEWAGVPWLGSVMAFMLAIGVLGGVVTWIAGPNTGVLAIAKAGYLPK 329 Shigella flexneri
WP_012015567 252 ATILILGTLTIAFVVPREETGGTQSLLITFINAFHWFGLSWATPILAFALAIGVLAGIVTWVAGPSSAMHSVAKAGYLPT 331 Salinispora tro...
WP_005174157 334 WWQHTNKNGMATHILLLQALLVSLLAILFVVLPSVQAAYQIMSQMTVILYLIMYMLMFSSAIYLRYSQPNRPRPYHI-PG 412 Yersinia entero...
WP_008763557 326 FFQKTNKLGVQKNILFVQGIAVTVLSLLFVVMPSVQSFYQILSQLTVILYLIMYLLMFSGAIALRYKMKKLNRPFRIgKS 405 Bacteroides sp....
WP_025760893 330 FFQKTNRHGMGHHLMFVQGIIVSVLSVTFVIMPSVQAAFQILSQLTVMLYLVMYMLMFASAIYLRHSQPDTKRPYRA-PA 408 Shigella flexneri
WP_012015567 332 FFHAANKNRMPIRIMLVQAVAVSAVAVVFVFMPSVQAAFQILSQLAGLLYLVVYLTMFASAIYLRYRQPDRPRPYRV-PG 410 Salinispora tro...
WP_005174157 413 GAIGMWIIGGAGLIGSILAFVFSFIPPSQITVGSPTEYVGILIASTLFFVILPFLIYIVRKPHWRDENSDFAPFTWQ 489 Yersinia enterocol...
WP_008763557 406 GNGLMWFIGGLGFCGSLLAFILSFIPPSQISTGSNTVWFSVLIIGALIVVVAPFIIYASKKPSWVDPNSNFEPFHWE 482 Bacteroides sp. 1_...
WP_025760893 409 ----LFFWATLGFLGSFLAFVLSFIPPEQIPTGSPTSYVLYLLVLVALFLLIPILIYAFRKSDWKDPNSDFEPFSWE 481 Shigella flexneri
WP_012015567 411 GLAGMWIIGGAGFVASALALASSLVPPSQIGIGSPARYLGLLVGLAALIITAPLLLFARRKPHWRDPASNVEPFAWE 487 Salinispora tropica
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap