Conserved Protein Domain Family
tyr_de_CO2_Ent

?
TIGR03811: tyr_de_CO2_Ent 
tyrosine decarboxylase, Enterococcus type
This model represents tyrosine decarboxylases in the family of the Enterococcus faecalis enzyme Tdc. These enzymes often are encoded next to tyrosine/tyramine antiporter, together comprising a system in which tyrosine decarboxylation can protect against exposure to acid conditions. This clade differs from the archaeal tyrosine decarboxylases associated with methanofuran biosynthesis. [Cellular processes, Adaptations to atypical conditions]
Statistics
?
PSSM-Id: 163523
View PSSM: TIGR03811
Aligned: 5 rows
Threshold Bit Score: 1175.78
Threshold Setting Gi: 62241050
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAM46082         10 EMNLNALFIGDKAENGQLYKDLLIDLVDEHLGWRQNYMPQDMPVISSQERTSESYEKTVNHMKDVLNEISSRMRTHSVPW 89  Enterococcus...
BAE02560         10 DTDLSALFIGDKAENGQLYKDLLGKLVDEHLGWRQNYMPQDKPMISAEQQTSPEFRGTVNNMKDVLDELSSRLRSQSVPW 89  Lactobacillu...
jgi:LVIS_182164  10 DLDLNALFIGDKAENGQLYKDLLNKLVDEHLGWRKNYIPSDPNMIGPEDQNSPAFKKTVGHMKTVLDQLSERIRTESVPW 89  Lactobacillu...
ABC68277          9 DTNLKALFLGDKGENVDLFKEILNKMIDEHVGWRQNYMPQDLPVITPQDRSSKEFQATADNMRSVFNVLSSRLRTESLPW 88  Carnobacteri...
BAD93616         10 DLNLNALFIGDKAENADLFKSTLVKLVNEHMGWRKNYMPQDKPLISEDEKTSKSFTNTVNKMDEVLDELSVRLRTNSVPW 89  Tetragenococ...
AAM46082         90 HTAGRYWGHMNSETLMPSLLAYNFAMLWNGNNVAYESSPATSQMEEEVGHEFAHLMSYKNGWGHIVADGSLANLEGLWYA 169 Enterococcus...
BAE02560         90 HNAGRYWGHMNSETLMPAILAYNYAMLWNGNNVAYESSPATSQMEEEVGLEFATLMGYKNGWGHIVADGSLANLEGLWYA 169 Lactobacillu...
jgi:LVIS_182164  90 HSAGRYWGHMNSETLMPALLAYNYAMLWNGNNVAYESSPATSQMEEEVGQEFARLMGYDYGWGHIVADGSLANLEGLWYA 169 Lactobacillu...
ABC68277         89 HSAGRFWGHMNSETLMPAIIAYTTAMLWNGNNVAYESSPATSQMEEEVGMEFATLMGYKNGWGHIAADGSIANLEGLWYA 168 Carnobacteri...
BAD93616         90 HSP-RYFGHMNSETLMPSILAYTYAMLWNGNNVAYESSPGTSQMEEEVGKDFAKLFNFDHGWGHIVADGSLACMEGLWYA 168 Tetragenococ...
AAM46082        170 RNIKSLPFAMKEVKPELVAGKSDWELLNMPTKEIMDLLESAEDE-IDEIKAHSARSGKHLQAIGKWLVPQTKHYSWLKAA 248 Enterococcus...
BAE02560        170 RNIKSLPFAMKAVDPTIVAGKTDWELSNMSTKEIMDLVEANGDK-IDEIKAKSARGGKDLDKLGKWLVPQTKHYSWLKAA 248 Lactobacillu...
jgi:LVIS_182164 170 RNIKSLPFAMKEVNPELVAGKSDWELLNMPTKEIMDLLENAGSQ-IDEVKKRSARSGKNLQRLGKWLVPQTKHYSWMKAA 248 Lactobacillu...
ABC68277        169 RNMKSLPFAIQEVAPEMVAGKSEWELLNMSTEEVLNILDQLQDQ-FDEIKARSARSGKNLEKLGKWIVPQTKHYSWLKAA 247 Carnobacteri...
BAD93616        169 RNVKSLPLAMKEVKPELVAGKSDWELLNMPADEIMDILNSQDDDtIDAIKAHSARGGMDLSKLGKWLVPQTKHYSWMKAA 248 Tetragenococ...
AAM46082        249 DIIGIGLDQVIPVPVDHNYRMDINELEKIVRGLAEEQIPVLGVVGVVGSTEEGAVDSIDKIIALRDELMKDGIYYYVHVD 328 Enterococcus...
BAE02560        249 DIIGIGLDQVIPVPVDSNYRMDINELEKIIRELASTETPILGVVGVVGSTEEGAVDGINEIAELRNKLVKEGIYFYFHID 328 Lactobacillu...
jgi:LVIS_182164 249 DIIGIGLDQVVPVPIDSNYRMDIQALESIIRKYAAEKTPILGVVGVAGSTEEGAVDGIDKIVALRQKLQKEGIYFYLHVD 328 Lactobacillu...
ABC68277        248 DIIGIGLDQVIAGEVNSEYRMDIDKLEAQIRDLAAQGIPTLGVVGVVGSTEEGQIDRIDQIIALREKLAKEGIYFYVHVD 327 Carnobacteri...
BAD93616        249 DVVGIGLDQVVPIPVDDNYRLDVNELEKTINKLVAEKTPILGVVAVAGSTEEGAVDPVDKVVELRNKLMKQGTYFYLHVD 328 Tetragenococ...
AAM46082        329 AAYGGYGRAIFLDEDNNFIPYEDLQDVHEEYGVFKEKKEHISREVYDAYKAIELAESVTIDPHKMGYIPYSAGGIVIQDI 408 Enterococcus...
BAE02560        329 AAYGGYGRAILLDEDNKLIPYKDLQSKFAEYNVFTEEENLVSEHTYNAYAAFPEAESVTIDPHKMGYIPYSAGGIAIQDI 408 Lactobacillu...
jgi:LVIS_182164 329 AAYGGYARALFLDEDDQFIPYKNLQKVHAENHVFTEDKEYIKPEVYAAYKAFDQAESITIDPHKMGYVPYSAGGIVIQDI 408 Lactobacillu...
ABC68277        328 AAYGGYGRSIFLDENDEFIEWDQIEAVYAKNGIFMEKNDWLTREVYESFKAISLAESVTIDPHKMGYIPYSAGGVVIKDI 407 Carnobacteri...
BAD93616        329 AAYGAYARALFLDEDGNFIPWDKLQEVHQKYGDFQENKEYISKDTYNAFKAISEAETVTIDPHKMGYVPYSAGGIAIRNI 408 Tetragenococ...
AAM46082        409 RMRDVISYFATYVFEKGADIPALLGAYILEGSKAGATAASVWAAHHVLPLNVAGYGKLIGASIEGSHHFYNFLNDLTFKV 488 Enterococcus...
BAE02560        409 RMRDVISYFATYVFEKGADIPALLGAYILEGSKAGATAASVWAAHKTLPLNVTGYGKLVGASIEGARRFYNFLSGLEFKV 488 Lactobacillu...
jgi:LVIS_182164 409 RMRDTISYFATYVFEKGADIPALLGAYILEGSKAGATAASVWAAHHTLPLNVTGYGKLEGASIEGAHRYYDFLKNLKFEV 488 Lactobacillu...
ABC68277        408 RMRDVISYFATYVFEKGADIPALLGAYILEGSKAGATAAAVWTAHKVLPLNVTGYGKLMGASIEGAYHFYHFIDGKEFKV 487 Carnobacteri...
BAD93616        409 TMRNIISYFATYVFDKRSKAPSMLGAYILEGSKAGATAAAVWTAHRVLPLNVAGYGKLIGRSIEAANRFYDFLNNLSFNI 488 Tetragenococ...
AAM46082        489 GDKEIEVHTLTHPDFNMVDYVFKEKGNDDLVAMNKLNHDVYDYASYVKGNIYNNEFITSHTDFAIPDYGNSPLKFVNSLG 568 Enterococcus...
BAE02560        489 GDKTIEVHPLTDPDFNMVDYVFQEKGNNNLVEMNELNHEFYNQASYVTGSIYGNEYLTSHTDFAIPDYGNSPFKFVNNLG 568 Lactobacillu...
jgi:LVIS_182164 489 AGKRISVHPLISPDFNMVDYVLKEDGNDDLIEMNRLNHAFYEQASYVKGSLYGKEYIVSHTDFAIPDYGDSPLAFVESLG 568 Lactobacillu...
ABC68277        488 GDKTIELHALTKPDFNMVDYVFNEKGNTDLVKMNKLNHDFYDYASYAKGGLYNNEFITSHTDFAIEEYGHSPFEFVNGLG 567 Carnobacteri...
BAD93616        489 NGQEIEVNPLTKPDFNMVDWTFNIKGNKDFAKMNDLNLAFYQEASFVKGPIYNNDFITSHTDFAQDGYGDSPKAYVKSLG 568 Tetragenococ...
AAM46082        569 FSDEEWNRAGKVTVLRAAVMTPYMNDKEEFDVYAPKIQAALQEKLEQIY 617 Enterococcus faecalis
BAE02560        569 VTEEGWKEAGKVTVLRAAVMTPYMNKAENFDYFAPKIKQAMQEKLEAIY 617 Lactobacillus curvatus
jgi:LVIS_182164 569 FSEVEWRHAGKVTIIRASVMTPYMNQRENFDYFAPRIKKAIQADLEKVY 617 Lactobacillus brevis ATCC 367
ABC68277        568 FSRKEWERADKVTILRASAMSPYMNDKEVFDEYAAKIEAAIQSKLEAIY 616 Carnobacterium divergens
BAD93616        569 FTDADWQKEKAVGILRACVLTPLLYDKDNFAEYADKIKSAMTEKLTKIV 617 Tetragenococcus halophilus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap