Conserved Protein Domain Family
arg_ornith_anti

?
TIGR03810: arg_ornith_anti 
arginine-ornithine antiporter
Members of this protein family are the arginine/ornithine antiporter, ArcD. This exchanger of ornithine for arginine occurs in a system with arginine deiminase, ornithine carbamoyltransferase, and carbamate kinase, with together turn arginine to ornithine with the generation of ATP and release of CO2. [Transport and binding proteins, Amino acids, peptides and amines]
Statistics
?
PSSM-Id: 163522
View PSSM: TIGR03810
Aligned: 11 rows
Threshold Bit Score: 602.426
Threshold Setting Gi: 499449866
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAR30325       6 KKIGLVALTALIISSSIGSGIFAIPTDMASAAAPGAALIAWLIAGLGVLALCLSIVNIGRKKPELS-GIVSYAEDGFGPF 84  Streptococcus r...
WP_011374083   8 KKIGLLALIALVISSSIGSGVFGLTSDLASASAPGPVLIAWVIVGFGILMLALSLNNLLMKEPELE-GIFSYAEKGFGPF 86  Lactobacillus s...
WP_011673769   6 GKIGLLTLSALVISSSIGSGVFGIMSDLARAAAPGPVLITWFIVGLGVMMLALSLNNLLLKEPELE-GIFSYPKKGFGPF 84  Pediococcus pen...
WP_011062887   6 QKLQLGALIALVVGSMIGGGIFSLPQNMAARADAGAVLIGWAITAVGMLTLAFVFQTLANRKPELDsGVYAYAKAGFGDY 85  fluorescent pse...
WP_009329882   5 KKLGLFALIALVIGSMIGGGAFNLASDMASGAGAGAILIGWIITGVGMIALAFSFQNLTTKRPDLDgGIFTYAREGFGHF 84  Bacillus
WP_000503408   5 KKLGLFTLTALVVGSMIGGGAFNLASDMAKGAGAGAIIIGWVITGIGMIALGLSFQNLTVKRPDLDgGIFSYAKAGFGNF 84  Bacillus cereus
WP_004198174  37 NKLRLGALTALVVGSMIGGGIFSLPQNMAATAEAGAILIGWAITAIGMLTLAFVFQTLANRKPQLDgGVYAYAQAGFGDY 116 pseudomallei group
WP_011668702   5 KGLSMGALTAAVVTSSIGSGVFTLTSSLAGGAAAGPVLLAWLVVGFGILMLALSLNNLLQKNPEAE-GVQAYAQAGFGNF 83  Lactobacillus b...
WP_012051342  11 QKLRLGALIALVVGSMIGGGIFSLPQNMAARADVGAVLIGWGITAVGMLALAFVFQTLANRKPELDsGVYAYAKAGFGEY 90  Pseudomonas putida
WP_011778655  23 AGLGLAALTALVVGSMIGSGIFALPSQMAGSAAPGPLLIGWVVTGVGMLMLAFVFQTLATRKPDVDgGVYGYARAGFGNY 102 Mycobacterium v...
WP_011137330   7 PRLKLGALTALVVGSMIGGGIFSLPQNMAAGAGAGAILIGWAITFVGMLALAFVFQMLASRKPEVSgGVYGYAKAGFGDY 86  Chromobacterium...
AAR30325      85 SGFISGWGYWLSAWLGNVAFATMMMKTLGRFFPIFGEGNNIVSITVASVILWCMYYIVNRGVEGAASLNTIITLCKLVPL 164 Streptococcus r...
WP_011374083  87 AGFISGWGYWLSAWLGNVAFATILMSALGYFFPIFKSGQNLPSILVASVLSWSLTYFVNRGVEGAAAINTLVTICKLIPL 166 Lactobacillus s...
WP_011673769  85 MGFISGWGYWLSAWLGSVAFATFLMSTIGYFFPILRSERNLPLILIASIFSWGLTYLVNRGIEGAAIINTIVTVCKLIPL 164 Pediococcus pen...
WP_011062887  86 MGFSSAWGYWISAWLGNVGYFVLLFSTLGYFFPVFGQGNTPVAIGCASVLLWAVHFLVLRGIKEAAFINQLTTVAKIVPL 165 fluorescent pse...
WP_009329882  85 MGFNSGWGYWFAALLGNVAYGTLLFSAIGYFIPAFGDGQNIASIIGASVILWCVHFLILRGVQSAAMINLITTISKLVPI 164 Bacillus
WP_000503408  85 MGFNSAWGYWLSAWLGNVAYGTLLFSSLGYFFPIFEGGQNVASIVGASVLLWCVHMLILRGVQSAALVNLVTTIAKLVPV 164 Bacillus cereus
WP_004198174 117 MGFSSAWGYWISAWLGNVGYFVLLFSTLGYFFPVFGEGNTPAAIAGASVLLWAVHFLVLRGIREAAFVNLVTTVAKIVPL 196 pseudomallei group
WP_011668702  84 AGFVSGWGYWLSAWLGNVAFATVLMSSLGYFFPLFKGGQNVPSVILASVVSWGLTYIVNRGVESAAAMNTIITICKLIPL 163 Lactobacillus b...
WP_012051342  91 MGFSSAWGYWISAWLGNVGYFVLLFSTLGFYFPVFGEGNTPIAIGCASLLLWSVHFLVLRGIKEAAFINQVTTVAKVVPL 170 Pseudomonas putida
WP_011778655 103 IGFTSAFGYWMSAWVGNVAYLVLLFSTLGYFFPSFEGGATVPAIIGASVVLWIVHAMTLRGVQTAALVNVVVTIAKVVPI 182 Mycobacterium v...
WP_011137330  87 MGFNSAWGYWISAWIGNVSYFVVMFSALGFWVPAFGDGNTPIAIACASVLLWALHFLVLRGVHGAAFINTITTIAKLVPL 166 Chromobacterium...
AAR30325     165 ALYIVLAILFFDFDTFMNNFWGTAS--GGFEFG-KIMEQVQNSMMVIMWVFVGVEGAAMMSDRAQSKSIIGKSTVLGLLG 241 Streptococcus r...
WP_011374083 167 FVFIIFGIVLFKGHLFTQAFWNNMS--SSFVAG-DVMSQIKNCMMVMMWVFVGIEGASMLSARAEKKSDAGKATILGLVS 243 Lactobacillus s...
WP_011673769 165 FVFIVFGIILFKGGMFTHAFWNNMN--NNFVGG-DVIGQVKNCMMVMMWVFVGIEGASILSARAEKKSDAGKATILGLIS 241 Pediococcus pen...
WP_011062887 166 VMFIVIAAVAFKADIFTRDIWGRSN----PNFG-GVMDQVRNMMLVTVFVFIGIEGASVYSARAQKRADVGRATVIGFLG 240 fluorescent pse...
WP_009329882 165 FAFIIAIIFVFHLDLFTNDFWGK-----GLSLG-SIGTQVKSTMLVTVWVFTGIEGAVLFSSRAKKSSDVGKATVIGLIS 238 Bacillus
WP_000503408 165 FVFIVIGIFAFHIDTFLDGFWGQT---GSFSWG-AVGSQVKSTMLVTLWVFIGVEGAVVLSSRAKNRSDVGKATVIGLIG 240 Bacillus cereus
WP_004198174 197 VVFILIGFFAFKLDVFRTDIWGRAN----PSLG-SVMNQVRNMMLVTVWVFIGIEGASIFSARAEKRSDVGRATVIGFVG 271 pseudomallei group
WP_011668702 164 FTFIVVGIFVFKGGMFTAHFWSNVS--SGVAGGaNIWTQFKSCLMIMMWVFVGVEGASMLSSRAKSKSEAGRATIIGIIC 241 Lactobacillus b...
WP_012051342 171 LIFVVIAAFAFRADIFTRDIWGLSN----PQFG-SVLEQVRNMMLVTVFVFIGIEGASVYSGRAQRRSDVGKATVIGFLG 245 Pseudomonas putida
WP_011778655 183 VVFIALAAVGFKAGLFTADFWGRTTeiDGAPLG-DTMTQVKNMMLVTVWVFIGIEGAAVYSQRAARRADVGRATVLGFAA 261 Mycobacterium v...
WP_011137330 167 ALFIALIVFAFKVDTFSLDFWGSAK------LG-SIVDQVKSTMLVTVWVFIGIEGASMFSGRAESMKDVGKATVIGFLL 239 Chromobacterium...
AAR30325     242 LLVIYVSASILPYGIMTQEQVAALHSPAMGYVLVDKVGNWFPVLVNIALIISIFGSWLSWTMLPAETTLVMANRHLLPQK 321 Streptococcus r...
WP_011374083 244 LLAIYILASVLPYGYLTQDQLASIKQPAMLYIFEQMVGTWGGYFIGVGLIISILGAWLSWTMLPAETMLLMAKQNLLPAY 323 Lactobacillus s...
WP_011673769 242 LLVIYILASVLPYGYLTQEQLATIKQPAMLYIFEKMVGTWGGYFIGIGLIVSILGAWLSWTMLPAETMLLMAKQKLLPEY 321 Pediococcus pen...
WP_011062887 241 VLALLVLVNVLSLGIMSQPELAQLQNPSLAAVLEHIVGPWGALLISIGLAVSLLGALLSWALLCAEILYATARDRTMPAF 320 fluorescent pse...
WP_009329882 239 VLVIYVMITMLSLGVMNQQNLAELPNPSMAAIMEHIVGKWGAVLINLGLIISVLGAWLAWTLFAGELPLIAAREGVFPKW 318 Bacillus
WP_000503408 241 TLIIYILITLLSLGLMQQADIAGLKNPAMAYLFESVVGKWGAIFINLGLVISVLGAWLGWTLLASEIPYLAAKDGVFPKW 320 Bacillus cereus
WP_004198174 272 VLLALVLVNVLSLGIMTQPQLAKLQNPSMAAVLEHVVGHWGAVLISVGLVVSLAGALLSWVLLCAEIMFSAAKDRTMPAF 351 pseudomallei group
WP_011668702 242 LLIIYVLASVLPYGYLSQDALAKINQPAMLYIFQDMVGTWGGAFIGVGLIIAILGSWLSWTMLPADTTMLMAEEKLLPAY 321 Lactobacillus b...
WP_012051342 246 VLALLVLVNVLSLGIMTQPELAGLQNPSLASVLEHIVGPWGALLISLGLAVSLLGALLSWALLCAEILYATARDKTMPRF 325 Pseudomonas putida
WP_011778655 262 VLALLLLVNLLSYGLVAQAELAGIPDPSMAGLLENEVGSWGAAFISIGLIISLLGALIAWVLLCVEILRLPALENVMPKA 341 Mycobacterium v...
WP_011137330 240 TIALLVAVSVLSLGVMTQAELAALKNPSTAYVLQKAFGTFGANLMNAGLVISVGGALLAWTLLAAEAPYLAGKDGVMPKV 319 Chromobacterium...
AAR30325     322 FGELNAAGAPTFSLVFMTGLTQIFMFTLLFTNQAYQFAYSLCTAAIFVSWLYVTLYQTKLSF--------KLGELPQTLV 393 Streptococcus r...
WP_011374083 324 FGRVNKKKAPTFALVVTAGLIQVFLFTLLFTTKAYNFAYSLCTASIIVCYMLVAAYQIKYSWah----lqEKGNRQQLLI 399 Lactobacillus s...
WP_011673769 322 FGKINDKKAPTFALILTAGLIQIFLFTLFFTTKAYNFAYSLCTAAVIVCYILVAAYQIKYSWth----ihEKGNHQQLVI 397 Pediococcus pen...
WP_011062887 321 LKKENANHVPVNALWLTNVMIQIFLLITLFSAGTYTSLIYLASSMILVPYLWSAAYAVLLSGrgetyeqaSRERKKDLFI 400 fluorescent pse...
WP_009329882 319 FGKENKNGAPTNALTLTNAIIQLFLLTFLISDAAYQFAFSLASSAILIPYLFSGLYQLKYSWlh-----kEPNRGKNLII 393 Bacillus
WP_000503408 321 FAKENKNKAPVNSLWITNGLIQMFLLTFVVSDQAYNFAFSLASSAILIPYAFSAFYQLKHSLks-----eEVDRNKNIVI 395 Bacillus cereus
WP_004198174 352 LRKENANHVPANALWLTNAMVQVFLLITLFSQSTYLSLIYLATSMILIPYFWSAAYALLIAVrgetyegdARARRKDLFV 431 pseudomallei group
WP_011668702 322 FGKKNKNGAPTFSLVLTAALIQIFLLVLLFSEEAYNFALSLCTAAIVVCYIFVGAYQVKFSY--------QNKDMKQFWI 393 Lactobacillus b...
WP_012051342 326 LAKENANHVPANALWLTNCMIQGFLLITLFSAGTYTSLIYLASSMILVPYLWSAAYAVLLAMraetyagqPRLRRKDLLV 405 Pseudomonas putida
WP_011778655 342 LAKENAHGSPATALWLTNLCVQALLLWTLANESTYTNLIYLATSLILLPYLWSAAYQVLLAVrget-yesGHGRTKDLLV 420 Mycobacterium v...
WP_011137330 320 FGTVNGNDTPAASLWLTNGLIQLFLLITLKSSAGYLALLSLATSMILIPYLLCAGYSWLVAQrgeg-yaqGEARGKELGT 398 Chromobacterium...
AAR30325     394 GLVGSIFYLWAIWASGIDYFLLCLIVYLLGIILYRQARKE---KGITeTF-SAKEKVLLVLIVAGAVIALFRLFTGQISI 469 Streptococcus r...
WP_011374083 400 GVLALLFEIAGILMAGVSYLLLCFIAYIPGIYFYGRARKN---NGHQhFL-SKGEWLITTIIVIGAIIGIWLVVSGKIVI 475 Lactobacillus s...
WP_011673769 398 GVLALLFEVIGILMAGLSHLLLCFIAYIPGIYFYGQARKN---NGHE-YFlSKGELIVTVFITIGALIGMGLVIMGKIIV 473 Pediococcus pen...
WP_011062887 401 ATVALSYAIWLLYAGGLKYLLLSALLYAPGVILFAKAKHE---QGEP-LF-TPLEKLIFAAVVIGASLAAYGLYSGLLAL 475 fluorescent pse...
WP_009329882 394 GIIASIYGVWLVYAAGLDYLLLTMILYAPGILVFRAVRKG---KEGP-VF-NKAELLIAALILVLAVIAVIRLASGSISI 468 Bacillus
WP_000503408 396 GLIASIYGVWLVYAAGLEYLLLTMTLYAPGIFIFYNVQKQ---KSSKqIF-TRVELASSVAIGALAFFAIYGLITGSITL 471 Bacillus cereus
WP_004198174 432 AALAVLYAVWLLYAGGLKYLLLSALLYAPGALFFAKAKRE---LGKP-VF-TAAEKLIFAAAAAAALAAAYALHSGLITL 506 pseudomallei group
WP_011668702 394 GFFALLFQVVAITLAGLHFLMLVCIGYLPGIYFYYRAKKDyslDGGK--L-TKMEILYSIAIVAFAIISIVMVAMGAIQI 470 Lactobacillus b...
WP_012051342 406 ALVALLYAVWLLYAGGLKYLLLSALLYAPGVILFARAKHE---QGQT-LF-TAWEKLIFAAVLVGAALAAYALYSGLLSL 480 Pseudomonas putida
WP_011778655 421 GVVALVYAVWLLYAGGWQYLLMAAVFYLVGTALYVWARRE---SGLP-AF-TKGELVVFAVVVVTSVAAIALLATGNLAV 495 Mycobacterium v...
WP_011137330 399 AILATVYGAWLIYAAGPKYLFLSMVLYAPGLLFYLWAKKE---QGQK-PF-NLIEAVLAAIVVVLAVIAVYMLATGQIGL 473 Chromobacterium...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap