Conserved Protein Domain Family
RR_plus_rpt_1

?
TIGR03808: RR_plus_rpt_1 
twin-arg-translocated uncharacterized repeat protein
Members of this protein family have a Sec-independent twin-arginine tranlocation (TAT) signal sequence, which enables tranfer of proteins folded around prosthetic groups to cross the plasma membrane. These proteins have four copies of a repeat of about 23 amino acids that resembles the beta-helix repeat. Beta-helix refers to a structural motif in which successive beta strands wind around to stack parallel in a right-handed helix, as in AlgG and related enzymes of carbohydrate metabolism. The twin-arginine motif suggests that members of this protein family bind some unknown cofactor.
Statistics
?
PSSM-Id: 163520
View PSSM: TIGR03808
Aligned: 6 rows
Threshold Bit Score: 763.2
Threshold Setting Gi: 501559289
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011925698   1 MDVNRRRILAGSAAGAAGAlALPTVAAEGAPLISTLGRDATQYGVKPNSPDDQTRALQRAIDEATRAQAPLALPPGVYRS 80  Bradyrhizobium ...
WP_011472211   1 MPLSRRHLLNAAAFAAGAL-ALPSKPARAAPLTSSLGRDASQYGVRPNSPDDQTRALQRAIDDAARAQTPLALPPGVYRT 79  Rhodopseudomona...
WP_011085830   1 MDLNRRHLIGASTAGIAGAlAMPADAARAAPLTSLLGRDATQYGVRPGSSEDQTRGLQRAIDEAARAQMPLALPPGVYRS 80  Bradyrhizobium ...
WP_011511093   1 MDIRRRHILGASAAGVAGAlAMPSGAARAAPLTSTLGRDATHYGVRPNSPDDQTRALQRAIDEAARANAPLALPPGVYRT 80  Nitrobacter ham...
WP_011442423   1 MTLDRRRLIGLTAGALALS----AAPLAAQPLTSQRGRDATQAGLRPDSSDDQTAALQRAIDSAARARVPLALPPGHYRT 76  Rhodopseudomona...
WP_012563785   1 MNLTRRRFVNSFSLSAA-VlTLESARAIAAPAVTPLGRDAGQLGVKHNSPDDQTIPLQRAIYATAAARTPLVLRPGIYRT 79  Oligotropha car...
WP_011925698  81 SMLRLSKGSKLIGVRGATRLVFTGGaPSLLSAEGADGADVTAVSLDGGGIALPQRRGLLHVAAGNDVRIIDCEITRSGGS 160 Bradyrhizobium ...
WP_011472211  80 GPLMLPNGAQLIGVRGATRLLFNGG-RSLLESQGGNAVELSGLTLDGAQIKLPQRRGLVHCQQGRELRITQCTIANSGGN 158 Rhodopseudomona...
WP_011085830  81 GLLRLPNGTQLIGVRGATKFVFTGG-PSAIQSDGADAIGLSGITFDGGGIPLPTRRGLIHVLGGRDVRITDCEITGSGGS 159 Bradyrhizobium ...
WP_011511093  81 GALQLTKGSQLIGVRGATTLMFSGG-ASLLSTEGADHIGLSNLTLDGGGIPLPERRGLIHCRGGRDVRILDCEITGSGRD 159 Nitrobacter ham...
WP_011442423  77 GPLRLPSGAQLSGVRGATRLVFTGG-VSLFDSAGAETPTLSGLVLDGGAIPLPARRGLVHCVGARDLRITDCEITASGGC 155 Rhodopseudomona...
WP_012563785  80 GELDLPSGAQIIGARGATRIEFTGG-TALLTAKGADGLVLTGLTLDGGGADLPQRRGLISLQACRDIHIADCDILGSRRN 158 Oligotropha car...
WP_011925698 161 GIWLEQVSGDVSGNVIIDIAVTAIVSFDALGLIVSRNTIKGTRDNGIEILRTAIGDDGTMVLDNHIEDIKAGPGGSGQYG 240 Bradyrhizobium ...
WP_011472211 159 GIWLDNIAGDISDNGFSNIATTGIVSFDAQGLIVARNSILGTNDNGIEILRSALGDDGTQVLDNRIEDIKAGPGGSGQYG 238 Rhodopseudomona...
WP_011085830 160 GIWLEQISGDISGNIFTSIAVTAVVSFDAKGLSVARNTIIGTNDNGIEILRSAIGDDGTLVADNRIEDIKAGPGGSGQYG 239 Bradyrhizobium ...
WP_011511093 160 GIRLENVAGEISGNVIVQTASTAIVSFDALGLTVARNTILDASDNGIEILRTAIGDDGSIVTGNRIEHIKAGPGGSGQYG 239 Nitrobacter ham...
WP_011442423 156 GVWLETTSGMISDNTLTAIAVTGVVSFDAKGLSVTRNTIIGANSNGVEILRTSIGDDGTLVTGNRIENIKAGPGGSGQYG 235 Rhodopseudomona...
WP_012563785 159 AIWLETCSGDIRNTTIRQTVATAIVSVDALGLLIAQNVIQDASENGIEILRSAPGDDGTIVTDNRIENIKAGPGGSGQYG 238 Oligotropha car...
WP_011925698 241 NAINAFRAGNVIVRGNRIRNCDYSAVRGNSASNIQIVGNSVTDVREVALYSEFAFEGAVISGNTVDGAAFGVSVCNFNEG 320 Bradyrhizobium ...
WP_011472211 239 NAINAFRAGNVVVRGNRIKNCDYSAVRGNSASNIQITGNSVSNVREVALYSEFAFEGAVIANNTVNGAAVGVSVCNFNEG 318 Rhodopseudomona...
WP_011085830 240 NAINAFRAGNVIVRGNRIKNCDYSAVRGNSASNIHITGNSVSDVREVALYSEFAFEAAVIANNIVDGAAVGVSVCNFNEG 319 Bradyrhizobium ...
WP_011511093 240 NAINAFRAGNVIISGNRISDCDYSAVRGNSASNIQITGNSVSGVREVALYSEFAFEGAVIANNTVDGAAVGVSVCNFNEG 319 Nitrobacter ham...
WP_011442423 236 NAINAFRAGNVIVSGNRIRNCDYSAVRGNSASNIHITDNSVSDVREVALYSEFAFEGAVISGNTVDGAALGVSVCNFNEG 315 Rhodopseudomona...
WP_012563785 239 NGINAYRAGNVIVRGNRIRNCDFSGIRGNSASNIQIIANNVTDVREVALYSEFAFEGAIIANNVVDGCTTGVSVANFNEG 318 Oligotropha car...
WP_011925698 321 GRIAVVQGNIIRNLIPKRPIGTAPDDDAGIGIYVEADSSVTGNVVENAPSYGIVAGWGRYLRDVVISGNVVRNALAGIGV 400 Bradyrhizobium ...
WP_011472211 319 GRLSVVQGNLIRNLTPKRPIGTAPDDDAGIGIYVEADTAVTGNVVENAPSFGIVAGWGRYLRDVAISGNVIRNAFVGIGV 398 Rhodopseudomona...
WP_011085830 320 GRIAVVQGNIIRNLIPKRPIGTAPDDDAGVGIYIEADTSVTGNVIENVPSYGIVAGWGKYLRDVAITGNVIRKALAGIGV 399 Bradyrhizobium ...
WP_011511093 320 GRIAVVQGNIIRNLLPKRPIGTAPDDDAGIGIYVEADTAVTGNVIENAPSFGMIAGWGKYLRDVAITGNVIRKSFIGIGV 399 Nitrobacter ham...
WP_011442423 316 GRLSVVQGNIIRNLKPKRPIGTAPDDDAGIGIYVEADTAVTGNVIENAPSFGIVAGWGKYLRDVAITGNVVRRAFIGIGV 395 Rhodopseudomona...
WP_012563785 319 GRLAIVQGNIIRNTRAKRDPGSD-IETGGHGIYVEADTTVTGNVVENAPVCGIVVGWGQYLRDVNVSDNVIRNAFVGIGI 397 Oligotropha car...
WP_011925698 401 SVVQGAGTALVSNNLISGTPRGAVIGLDHIKPVTSDLTQDGAQRFAQLTMAGNAVR 456 Bradyrhizobium sp. ORS 278
WP_011472211 399 SVADGAGTALVGNNVISETPRGAVVGLDHARPVTPDLAAPGAAKFAQVVMGINAAR 454 Rhodopseudomonas palustris
WP_011085830 400 SVVPGAGTALVNNNMISETPRGAVVGLDHARAVTADLSADGAQRFAQVVVGGNAVR 455 Bradyrhizobium diazoefficiens
WP_011511093 400 SVVDGAGTALVNTNVISDTPRGAVVGLDHAKPVTPDLAAHGAAKYAQVAIGANAVR 455 Nitrobacter hamburgensis
WP_011442423 396 SVMDGAGTAAINGNVIAEAPRGAVVGLDHARPVTPDLTAPGAAKFAQIALGSNSVR 451 Rhodopseudomonas palustris
WP_012563785 398 SAMDGTGKTLVTGNLISNAPRGAIVGYDHYKPITGDLAVIGASEFPKIVLGLNTVQ 453 Oligotropha carboxidovorans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap