Conserved Protein Domain Family
chp_HNE_0200

?
TIGR03806: chp_HNE_0200 
conserved hypothetical protein, HNE_0200 family
The model TIGR03805 describes an uncharacterized protein family that contains repeats associated with the formation of a right-handed helical stack of parallel beta strands, homologous to those found in a number of carbohydrate-binding proteins and sugar hydrolases. This model describes another uncharacterized protein family, found in the same species as TIGR03805 member proteins, usually as the adjacent gene or in a fusion protein. An example is HNE_0200 from Hyphomonas neptunium ATCC 15444. Sometimes two members of this family are with a single member of TIGR03805. The function is unknown. [Hypothetical proteins, Conserved]
Statistics
?
PSSM-Id: 163518
View PSSM: TIGR03806
Aligned: 12 rows
Threshold Bit Score: 405.246
Threshold Setting Gi: 499872454
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011072834 566 NCPKLSDYNLF-S--DAkNP-TAAANSGGVPYDLNTPLFTDYASKYRFVYLPSGQKASYSENETFDFPVGSVIVKTFALP 641 Shewanella onei...
WP_011072835  62 DCPQLSQYGLFvD--PA-NP-TSQPQTPGFSYQLATQLFSNYANKYRFIYLPAGTSMQFQAQETFEFPIGAVLVKTFALP 137 Shewanella onei...
WP_011397664  61 NCRYLSSYRLF-S--GA-DP-TQTTDGSGVVYDLASPLFTDYASKYRVVYVPEGKQAQYSEQEVIDFPEGTVITKTFALP 135 Hahella chejuensis
WP_011920850  31 YPDKLSAWGVL-Q--QR-GG-QLQPAAGVLPYDLNTPLFTDYAHKLRTVWMPAGRSAHY-AEARFDYPVGTVLSKTFYYP 104 Pseudomonas men...
WP_011645233  36 PAPVLSDYGLF-S--D--VA-GAVPAQGVLPYELINPLFTDHAAKHRLVFVPKGASASFNAEDVFSFPVGTVLVKTFAFA 109 Hyphomonas nept...
WP_011421673  40 PAQRLSDLCLV-E--AA-GGgTVAPRAGVVPYDLNTPLFSDYALKTRTVWLPPGTRAAYTADAPLDLPVGAIVTKTFALP 115 Anaeromyxobacte...
WP_011557032  92 PPNTLSGFGLF-TgtPA-TG-GLQPVEGNIPYELTTPLFSDYSVKSRTLYIPPDAQAGYSANDVLDLPVGTIITKTFSFP 168 Myxococcus xanthus
WP_011541671  36 MPAKLSVFGLF-R--G--ND-PLRPVAG-IAYTLRTPLFSDYADKHRFMLIPEGKRATVATDGAIDFPVGTVLIKSFGWS 108 Sphingopyxis al...
WP_011413441  40 lPKSLDDFAFF-A--D--VR-AQAPNAGVVPYGLNVPLYSDGAEKLRFLYVPTGQQIGANGEGLLQFPVGSALIKTFAFG 113 Erythrobacter l...
WP_011395320  36 PPAKLSSWEIF-T--IT-EN-KLSLNREYLPYNVKLELFADYAKKYRAIKVPVGKKIRADASGVLSYPEGTVLVKTFYYP 110 Hahella chejuensis
WP_011394019 410 VPELLSQTGCV-N--P--DN-PTQPASGLIPYTVIEPFWSDGADKQRFFALPNDTYIDVNAAGDFLFPDGSVLVKHFYL- 482 Hahella chejuensis
WP_011553188 549 FPTLLSATGCA-D--P--TN-PNLPSAGLIPYGVNAPLWSDGAGKERFIGVPDGAVMTVGPEGVLDAPPGTVTVKTFLL- 621 Myxococcus xanthus
WP_011072834 642 SD--Tskr------------giS-N----------------ESLIETRLLIHRPTG-WSALPYVWNADRtdATLAKAGAI 689 Shewanella onei...
WP_011072835 138 QDtaItg--------------pT-N----------------ETLIETRLLIKRAQG-WTSLVYQWQQGQ--AKLITAGAT 183 Shewanella onei...
WP_011397664 136 ADtaNrg--------------lE-N----------------ERLLETRLLIRRASG-WAALPYIWDANKedAELSVAGGN 183 Hahella chejuensis
WP_011920850 105 RD--VqgrllrseqhgvealqlD-R----------------VRLLETRILLRQEQG-WVALPYVWDEAQrdATLDWAGTS 164 Pseudomonas men...
WP_011645233 110 PD--Mrv-------------pdE-G----------------AYRVETRLLIHKTEG-WAAYPYVWNEDQteAVYRPAGKR 156 Hyphomonas nept...
WP_011421673 116 PD--Lrs--------------pTvG----------------VRLLETRLLVRTAQG-WRGYPYLWNAAQtdATFQPGGAV 162 Anaeromyxobacte...
WP_011557032 169 AD--Lrv--------------pEeN----------------VRAIETRVLVHRPGG-WEAFPYFWNEAQteATLANGGRV 215 Myxococcus xanthus
WP_011541671 109 DV--N-------------------A----------------GRPVETRLLIRRASG-WAALPYIWDADGkdATLALGGRR 150 Sphingopyxis al...
WP_011413441 114 EG--------------------T-E----------------RRLIETRVLLHRADG-WLALPYRWNEEQteARLALAGGR 155 Erythrobacter l...
WP_011395320 111 SA--Dts--------------pP-NtspalvqtltrniardSSLIETRVLIKRGSV-WQPLVYRWNKSKsdAELLNGGG- 171 Hahella chejuensis
WP_011394019 483 ------------------------N----------------GAIIETRLFMKQAEGdWRGYSYQWNETKtdAVLVAEGKD 522 Hahella chejuensis
WP_011553188 622 ------------------------G----------------GKRVETRLFMRHPDGiWAGYTYEWNDAGtdATLLETGKV 661 Myxococcus xanthus
WP_011072834 690 S-SQTLTH-KGQNLTFNYVVPNMNQCKQCH---QFKADdksnavFVPIGPKARHLNRNYSYQDGTM--NQLLKWENLGIL 762 Shewanella onei...
WP_011072835 184 V-SHSLIN-QGQSQRFDYNIPSRAECKVCH---QINQDnt--sqIIPIGLKAHLLNSEIDYQGQTV--NQLSLWAEQGKL 254 Shewanella onei...
WP_011397664 184 Y-AATVVH-NGVQHNFTYQVPDTNKCKQCH---QFKTDsg--srFVPLGPKARQLNWTYAYPSGAA--NQLAYWKQKGII 254 Hahella chejuensis
WP_011920850 165 F-DLQLQDaTGEGLAVDYQVPDANQCAGCH---EQQAGk----gVQPLGPKARHLNKDYVYADGTV--NQLQRWQADGLL 234 Pseudomonas men...
WP_011645233 157 I-DIETVSpAAETLQLRYAVPNQNQCKTCH---QAGDA------IEPIGPKARHLAHE----------GQLTRWVEAGIL 216 Hyphomonas nept...
WP_011421673 163 L-QLPLVTpSGAAVTASYLVPSVTQCARCH---ADTPDg----aLHLLGPTARNLNRSHDYPGGAE--NQLAHWTAAGIL 232 Anaeromyxobacte...
WP_011557032 216 VrGVRFIGeDGVERTLDYLVPSKNQCLKCH---HLQDAqen-qvLLPIGVKARYLNQDHDYGDGPI--NQLQHLANLGRL 289 Myxococcus xanthus
WP_011541671 151 V-PVSFTTaAGERHAIRYAVPNRNQCKECH---SLNGE------IVPIGPKVRNLVLD---PAASA--SLRARYFDQ--- 212 Sphingopyxis al...
WP_011413441 156 L-AI--TRpDGE--EISYRIPNKNQCKECH---SVDGA------IVPIGPKGRNLSGEW-----------LGEIYEAGLL 210 Erythrobacter l...
WP_011395320 172 L-ETISADsQLEPQNFTYLIPSRHQCVDCHggyDLSGD------LAPLGPVIEQLNIEVKYASKAV--NQLELWF----L 238 Hahella chejuensis
WP_011394019 523 V--------DYSGQTWRF--PGSGECAQCH---TSAAD-------FSLGLETMQLNRELIYPQSRIraNQLQTLTHINVF 582 Hahella chejuensis
WP_011553188 662 K--------TVGTQTWTY--PSRGECMQCH---TAAAG------FV-LGLEVAQLNGDYTYPGGRIa-SQLQTLEHIGVL 720 Myxococcus xanthus
WP_011072834 763 QGLP-NLSQVSQVPAYQDg-DettvaslsDSALMQTAKGYLDINCAHCHRPEGNA-SNTGLKLeywrG----Y-SDDAGF 834 Shewanella onei...
WP_011072835 255 SQLP-DVKLVAKTYAIDN--S--------QADLTARAKGYLDVNCAHCHSAKGFA-SISGLQL----G----FyIDHTSY 314 Shewanella onei...
WP_011397664 255 SGLPdDLSSIDSVPSYSDa-DasnlagysDDQIHRLAKGYLDVNCAHCHRPEGGA-SNTGLSL----EfwrsF-ADYQS- 326 Hahella chejuensis
WP_011920850 235 QGVPaDLAGVPRNALWGAprE--------GEGLEHQARSYLDANCSHCHNPEGPG-RTSGLYL----D----P-ATPLGI 296 Pseudomonas men...
WP_011645233 217 DGLP---EGVAGEPYAFD--V--------SQPLDARARAWLDINCAHCHKADGSA-SNSGLWL----P----A-TEQTGA 273 Hyphomonas nept...
WP_011421673 233 EGAP-PPAEAPRLPVWNDp-A--------TGTVVERARAWLEVNCAFCHSPGGLA-RTTGLYL----G----T-GVTDPY 292 Anaeromyxobacte...
WP_011557032 290 TGLP-PVNQVPRAPNAFNa-E--------DGTLEQRARTYLDINCAHCHNPKGTAgTTSRLFL----N----V-DNTEEF 350 Myxococcus xanthus
WP_011541671 213 -----PAALEPAMPVWDDp-A--------SGSIADRARAYLDVNCAHCHNPAGSA-SNSGLFL----Rw---T-DDPAGV 269 Sphingopyxis al...
WP_011413441 211 DEVN-D--GMDMMPNWASr-D--------TMPAAQMARAYLDVNCAHCHRPGGSA-SNSGLDL----R----L-EQRDPI 268 Erythrobacter l...
WP_011395320 239 SGLL-TLDTIPQNNTVLD---------------TNSARDYLHVHCGHCHNANGLA-SSSRLYL----T----R-DIQNLY 292 Hahella chejuensis
WP_011394019 583 SAPLsDAHLSNALPASSN--D--------NATLARRARAYLHSNCANCHQPGGT--SQSAMDL----R----F-TTALSS 641 Hahella chejuensis
WP_011553188 721 KLPA-PVEQLPRMPAYAGp-E----------PVETRARAYLHANCAVCHRPNGLG-RGE-LDL----R----F-STPLAA 777 Myxococcus xanthus
WP_011072834 835 SHGTCKSPVAYGGGNLG--FDVVPGNAAKSIMHFRMQSTSPGDRMPEIGRSLAHDEGVALISEWIKRL 900 Shewanella oneidensis
WP_011072835 315 QYGICKQPPGWDGGPKGldYDIVPGNAEHSILLYRQTLSEPKDRMPPIGRNLEHQEGVELIRQWIDSL 382 Shewanella oneidensis
WP_011397664 327 QHGVCKQPVAYGGGALS--YDIEPGSPDASIFNFRMETDQPGDKMPEIGRQLVHQEGQALIYEWIARM 392 Hahella chejuensis
WP_011920850 297 AYGLCKQPVAAGKGSGDrlVDIHPGAPEKSVLSFRLHSTDPSIMMPELGRSTSHREGLEVIDRWIASL 364 Pseudomonas mendocina
WP_011645233 274 RIGLLKHPVAAGRGSGGlkQVIVPGDPDASILLYRMASTEPGVAMPELGRSVSDPESLALIREWIGAM 341 Hyphomonas neptunium
WP_011421673 293 QLGVCKPPVAAGPGSGGlaYDVVPGDPDASILAYRVAATDPVAVMPQLGRSVVSEEGLALVRQWIAEL 360 Anaeromyxobacter dehalogenans
WP_011557032 351 TLGVCKRPGSAGG-GVGgeFDIVPGSHSVSILWYRMHTEESGKMMPELGRVLRHDQGSRLISDWIDAM 417 Myxococcus xanthus
WP_011541671 270 NYGIGKRPTAAGRGSGGmdFAIAPGDPERSFMIYRLESTDPGIAMPEVGRSTVHREGAALLRQWIAEM 337 Sphingopyxis alaskensis
WP_011413441 269 KIGILKRPVAAGRGSGGheFDIAPGHPERSILVHRMGSTEPGVAMPELGKSTVDEEALEVIERWIAQM 336 Erythrobacter litoralis
WP_011395320 293 RLGVCKPPIAAGNASLGlkYDIVPGKPEKSLLLRRLSSVTPEVMMPELGRSRVDQEGVDLVSAWIRQL 360 Hahella chejuensis
WP_011394019 642 TQACGQEPLNGDIGVDNakL-ITPGDASMSLIYLRMTHSG-EYRMPPLASNLIDTEGGALVQDWINSL 707 Hahella chejuensis
WP_011553188 778 TKICGVAPDHGELGVPGa-MVVAPGDPSKSVLSRRMHSLS-TPRMPPLASAVKDKEGTGLVDAWITSL 843 Myxococcus xanthus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap