Conserved Protein Domain Family
beta_helix_1

?
TIGR03805: beta_helix_1 
parallel beta-helix repeat-containing protein
Members of this protein family contain a tandem pair of beta-helix repeats (see TIGR03804). Each repeat is expected to consist of three beta strands that form a single turn as they form a right-handed helix of stacked beta-structure. Member proteinsa occur regularly in two-gene pairs along with another uncharacterized protein family; both protein families exhibit either lipoprotein or regular signal peptides, suggesting transit through the plasma membrane, and the two may be fused. The function of the pair is unknown. [Unknown function, General]
Statistics
?
PSSM-Id: 163517
View PSSM: TIGR03805
Aligned: 10 rows
Threshold Bit Score: 408.682
Threshold Setting Gi: 499714587
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011397663  56 IKTAFITAQSGDYLVLPEGRLQITDTLTLD---------GDpdgdgasleNITIAGYGMD----------K--TILDFSG 114 Hahella chejuensis
WP_011643916  39 LMEQLIDAQPGDVIEIPAGVYSFDRSLSLN---------ID---------GVTIRGAGMD----------E--TILSFQD 88  Maricaulis maris
WP_011645232  48 LQAALIAAKPGETILLPEGVFQLTDGLSLD---------VD---------GVTLRGAGQE----------K--TILDFTG 97  Hyphomonas nept...
WP_011541672  38 LQEALILAQPGDVVELGAGVWKLTDGLSLD---------VA---------NVTLRGAGTG----------EggSILDFSG 89  Sphingopyxis al...
WP_011413440  43 LQEALILAEPGDEIVLGVGRFMLTDGLSLD---------VD---------GVTVRGAGMD----------A--TVLDFGG 92  Erythrobacter l...
WP_011643583  43 LVERLAAASPGDIIDIPEGVFAFDRTLVVA---------AD---------NLILRGQGAD----------R--TILSFQD 92  Maricaulis maris
WP_011421672  49 IQGAVALAADGSTFVFGPGTFRFANALEVA---------AN---------GVTIRGAGRD----------A--TVLDFAG 98  Anaeromyxobacte...
WP_011866201  68 IQEALINAQSNDVIVLPKGHFKIESTLLFDgdvdgdgayAK---------NITIMGYGME----------E--TVLDFSE 126 Shewanella loihica
WP_011557031 109 LQDAVNALDDCTTINLGAGTFQFDNAITIR---------AN---------GITVKGAGKGtqgeatggesS--TVLDFTH 168 Myxococcus xanthus
WP_011395321  39 LYKLLDRAENGDTIILPHGNFFLDRELRVS---------TK---------GLTITGAGPR----------E--TILDFSN 88  Hahella chejuensis
WP_011397663 115 SLGGDGIFIQNMKDVTVRNLAVEEAANNGIKLKDSDGIRLQYTRTEWKGALTSDNGAYGLYPVECSNILIEDSYVRGSAD 194 Hahella chejuensis
WP_011643916  89 QIAGAEGLIVTANDFTLENLAIEDTIGDGLKVNGGENIIIRGVRVEWTNGYATENGAYGIYPVQTTNVLVEDTVAIGASD 168 Maricaulis maris
WP_011645232  98 QEGAGEGLLVTSDDVLLMDFGVRNTKGDGIKSKGADQIIYRYLTVEWTGGPDEANGAYGVYPVESKNVLVENVTVRAASD 177 Hyphomonas nept...
WP_011541672  90 QQGAGEGLLVTSDDVLLTNFAVLNTKGDGIKSKGADRIVYHKLRVEWTAGPKATNGAYGIYPVESTDVLVDSVYVRGASD 169 Sphingopyxis al...
WP_011413440  93 QQGSGEGFLITSDDVTVRDFALENPKGDGVKSKGADNIVYYRVRVTWTDGPKASNGAYGIYPVESTGVLVDGVKVSGASD 172 Erythrobacter l...
WP_011643583  93 QVMGSQGVRITANRVSLESLAIEDPVGDGVSVLGSDGVGIRGVRVEWTGGPAADNGAHGIALDEASNILIEDSIAIGAAV 172 Maricaulis maris
WP_011421672  99 QV-GAEGVGASGDAFTLSDLSIRDTAGNGVKVVGAAGVTIRNVGVSWTRPDLSTHGGYGIYPVQSTDVLVEGCFTSGATD 177 Anaeromyxobacte...
WP_011866201 127 SITGDGIFVQNAVNITIQDLSVNEAKNNGIKLKNTNGIILRRLATVWEGALDEDNGAYGLYPVECENILIEDTYVRGSAD 206 Shewanella loihica
WP_011557031 169 AAANTNGFDVVSKLFTVSDLAVWNAKKDGLRIESSTNVNIQRIRTEWAQENQQSNGKYGIYPVKSTYVLVEDSEAYNAAD 248 Myxococcus xanthus
WP_011395321  89 QKQGAQALFVRGWNITLKNFSIAHPGGDGVVIRNSSKVLISNLRINMGEAPKSSNGGYGIYPVSSRHITIENTEVSGASD 168 Hahella chejuensis
WP_011397663 195 AGVYVGQSSNIVVRRNVAKENVAGIEIENSQNADVYNNVAEGNTGGILVFDLPIGNHKyGSTVRVFNNIIRDNNTDNFAN 274 Hahella chejuensis
WP_011643916 169 AGIYVGQSRNVIVRNSRAEYNVAGIEIENCIGADVYGNTATNNTGGILVFNMPNLPQP-GYHTRVYDNDIFANNTENFGH 247 Maricaulis maris
WP_011645232 178 AGIYVGQSDNIIVRNSVVEYNVAGIEIENSMNADVYGNIARNNTGGILVFDLPDLPVSgGNSTRIFDNEIIENNTRNFAP 257 Hyphomonas nept...
WP_011541672 170 AGIYVGQSKNIVVRESVVTENVAGIEIENSYNADVHDNIANRNTGGILVFDLPSLPMQgGHNVRVFSNIVSDNSVPNFAP 249 Sphingopyxis al...
WP_011413440 173 AGIYVGQSSKITVRNSIAEANVAGIEIENSRDAIVENNITTRNTGGILVFDLPDLPVMgGGNVIIRRNLVVANDEPNFAP 252 Erythrobacter l...
WP_011643583 173 AGLHLGQSRNVVVRGNRTESNLVGIQVENTIGADLHDNAATRNTAGILVSSTPGQGQV-GRMTRIFHNHLFANNVDNPAP 251 Maricaulis maris
WP_011421672 178 TGIYVGQSQNIVVRNNEATGNVAGVEIENSYDADVHGNHLHGNTAGVLVFDLPGLPQQgGHHVRVFDNRILDNDHPNFAP 257 Anaeromyxobacte...
WP_011866201 207 AGIYVGQSEYIVVRRNIAKENVAGIEIENSKYADVYDNEAMGNTGGILVFDLPINNHRyGSSVRIFNNKVYNNNTPNFAN 286 Shewanella loihica
WP_011557031 249 AGIYVGQTQHTIVRRNVAKKNVAGIEIENTKYAHVTNNVAEDNTTGLVVFDLPGNPIR-GTDIYVAHNTITGNNRPNFAS 327 Myxococcus xanthus
WP_011395321 169 AGIYIGQSIYTLIQNNYSHDNVTGVNAENSQHVHVKNNRLQNNTVGALIVSLPDMLYPkSDNIIFEENIIDDNNLKNFAL 248 Hahella chejuensis
WP_011397663 275 A---SSNpagVHIVPPGTGVIVLSTADVEVYNNAISNHDTTSVTVSSFFIAasqt---emeqYVMDDIMADGWRSVP-RN 347 Hahella chejuensis
WP_011643916 248 A---GTP---VASVPAGSGVVINSNDQVEIFNNRISDNDTANIIISSLHST-----------GYSDYSVQTDFDPYP-ES 309 Maricaulis maris
WP_011645232 258 A---GNI---VASVPSGTGVIVMANRNVHVFDNNFDNNRSAHVLIMSYSEP----------------FTDETYNPLP-RD 314 Hyphomonas nept...
WP_011541672 250 A---GNI---VASVPTGTGVLVMANRNVEIFDNIFDQNGTANVMIVGYRYE----------------HKDPKYQPLP-RA 306 Sphingopyxis al...
WP_011413440 253 P---GNI---VASVRRGTGILVMANEDVLIEGNIVTNNPTAGAMVIAYTQP----------------FEDERYNPYA-RN 309 Erythrobacter l...
WP_011643583 252 A---RSP---LAALPAGSGIVLSASDQVEIFGNVIADNRTANMIITARQST-----------GLPATSPPDGFDPYP-EA 313 Maricaulis maris
WP_011421672 258 A---GGI---VAIVPAGSGVVVMANHDVEVFGNTIQGNQTAAVGVISYLLT-----------G---QAPPDGYDPFP-RR 316 Anaeromyxobacte...
WP_011866201 287 A---SSNpagVHIVPPGTGVIILSTNDVEIFNNEITGHDTLGVTVSSFFIAepdmtsfvgnyGQPGQPIEDGWRPTP-RN 362 Shewanella loihica
WP_011557031 328 VeasSST---VSQVPAGTGTFILASRRVEMERNTWGNNNTVDIAILSGLAI-----------EPDPVQWAAGFFNYPsQD 393 Myxococcus xanthus
WP_011395321 249 E---GNV---VSQFSPGIGIALIATSNVFINSTVLSKNDNADILIAGYHF-------------LNRPPYGAAFTPWV-KS 308 Hahella chejuensis
WP_011397663 348 ISIHDNSISDSGG--------NPRGDLI--QGVLPAFQAIGeTT------LPSVLYDGF 390 Hahella chejuensis
WP_011643916 310 IWIHDNTYSGGGT--------SPDGLDL--TALKIAMFGLN-GA------LPDVLFDGF 351 Maricaulis maris
WP_011645232 315 LVLRDNDYGAGGD--------DPQG------DLAPLAAALG-GQ------LPAIVWDGV 352 Hyphomonas neptunium
WP_011541672 307 IVVRDNQHGKAGY--------APAF-----PGGAEIAAAMG-GT------LPPVLWDGs 345 Sphingopyxis alaskensis
WP_011413440 310 VVIGSNVFADNGT--------DPQ---L--DAAEQLLAAFG-GA------LPPVLWDGI 348 Erythrobacter litoralis
WP_011643583 314 IHIHGNTFYDGGN--------NPDGLDL--QGLRLVLAGPL-GR------LPDILWDGH 355 Maricaulis maris
WP_011421672 317 VHVHGNTISGNGT--------APDDATPlgAALGQVRAALG-SD------LPDVLWDGI 360 Anaeromyxobacter dehalogenans
WP_011866201 363 IYLHDNVITDYGK--------KPNGYLI--EDIIKAYLLSH-GA------FPGILYDGL 404 Shewanella loihica
WP_011557031 394 ISIHDNTFTGGSGrmvdngtpDPERRPL--GALVGAVYQYG-AAahgvtgVEHVLWDGV 449 Myxococcus xanthus
WP_011395321 309 TSIS-----------------NPFG-------------------------AVNILWDGE 325 Hahella chejuensis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap