3FDD


Conserved Protein Domain Family
asp_4_decarbox

?
TIGR03801: asp_4_decarbox 
Click on image for an interactive view with Cn3D
aspartate 4-decarboxylase
This enzyme, aspartate 4-decarboxylase (EC 4.1.1.12), removes the side-chain carboxylate from L-aspartate, converting it to L-alanine plus carbon dioxide. It is a PLP-dependent enzyme, homologous to aspartate aminotransferase (EC 2.6.1.1). [Energy metabolism, Amino acids and amines]
Statistics
?
PSSM-Id: 163513
View PSSM: TIGR03801
Aligned: 14 rows
Threshold Bit Score: 895.512
Threshold Setting Gi: 489663756
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3FDD_A        11 LSPFELKDELIKIASG----D-GNRLMLNAGRGNPNFLATTPRRAFFRLGLFAAAESELSYSymnTVGVGGLAKIEGIEG 85  Pseudomonas dac...
WP_012058155  18 ISPFEFKNELINLAEGqr-kK-SARTLLNAGRGNPNWTAATPREAFFTFGIFAVEETRRVWN---DGDLAGMPKKEGIAE 92  Clostridium bei...
WP_011948813  18 ISPFELKDRLISLAKEsqieK-SAHALLDAGRGNPNWTAAAPREAFFAFGQFAVEETRRVWS---DGALAGMPKKEGIYK 93  Clostridium bot...
WP_011010163  18 ISPFEFKNKLIDLAKDk---K-SAHILLDAGRGNPNWTASTPRDAFFTFGHFSVSETKRTFE---SCDLAGIPHKEGIYN 90  Clostridium per...
EXY13887      21 ISPFELKNKLIEMADEsi-kK-IAHTMLNAGRGNPNWIATTPREAFFLLGKFGLEECRRVMYl--PEGIAGIPQKDGIAA 96  Bacteroides fra...
WP_011989267  18 ISPFELKDKLINLAKNq--kKkSVRTLLDAGRGNPNWVAITPREAFFTFGQFAAEECRRTWN---QDTLAGMPQKKGIDK 92  Clostridium klu...
WP_004454813  16 ISPFEFKDKLIDIAKYta-kE-NNRELLDAGRGNPNWTCSTAREAFFTFGHFAITETRSNWDl---GHLAGMPQKKGIKE 90  [Clostridium] d...
WP_011298857  12 LSPFELKDELIKLASS----D-ADRLMLNAGRGNPNFLATIPRHGFWQLGLFAMRESERSFSy-mPEGVGGFPRREGIEE 85  Cupriavidus pin...
BAC48742     129 LSPFEIKDELINLAKAts-kR-TQAAFLNAGRGNPNWVATTPREGFFLLGQFAITESKRVMEh--PAGIGGMPQAKGIAA 204 Bradyrhizobium ...
WP_010032119   6 LSPFEFKDELIKLATS----K-ADRLMLNAGRGNPNFLATIPRHAFLRLGDFALRESERSYSy-lNNVFGGLPEKKGITE 79  Francisella tul...
3FDD_A        86 RFERYIAENRDQEGVRFLGKSLSYVRDQLGLDPAAFLHEMVDGILGCNYPVPPRMLNISEKIVRQYIIREMGADAIPS-E 164 Pseudomonas dac...
WP_012058155  93 RLYNFLDKNKEMPGIELLRRIIDYGIKNQGFDADSWIFELTDSIIGDNYPVPDRMLIHIEKIVHEYLVSELCYNKPPV-G 171 Clostridium bei...
WP_011948813  94 RFREYIEKHKREPGIELLNNIVHYGIEVKGFDEDCFVYELADGIIGDNYPVPDRMLIHIEKVVQDYLMQEMCYNKPLK-G 172 Clostridium bot...
WP_011010163  91 RFLKFLEENKSFPAIELLEKIINYGIKEKGFNPDDFLYELCDAIIGDNYPYPDRMLPHIESIVHDYLLKELCY-LPPS-K 168 Clostridium per...
EXY13887      97 RFETFLKTNHSQPGAELLKGTYQYMLLEHAADPDTLVHEWAEGVVGDQYPVPDRILQFTEMIVQDYLAQEMCDRRPPK-G 175 Bacteroides fra...
WP_011989267  93 RFYTYLEDHKNSPGVELLKNIINYGINFQGFIAEDWIYELTDGIIGDNYPTPNRMLIHVEKIVHQYLIERIYNIKDSS-L 171 Clostridium klu...
WP_004454813  91 RFFKFINENIDMPGAYLARDIINFGINELGFDGDEFVHELADGIIGDNYPLPDRMLPHMEKIVHDYLVQEMKYDISGKyG 170 [Clostridium] d...
WP_011298857  86 RFDLFAREFAHVPGVSFLAGAVSYVRDQLGLNAGAFLYEMCEGILACNYPVPDRMLKLSEVIVGQYIRKEMIGNHPFI-G 164 Cupriavidus pin...
BAC48742     205 RYEAWLAKHSDMPGASFLSDMLPFSVKKFGFEPDAFVHELVDSIIGDNYPVPDRMLVHNEKIVHEYLMWAVCGEPRPA-G 283 Bradyrhizobium ...
WP_010032119  80 RFDYYCLAHDKQDGIDFLRAAISFVDDHLGINKEEFLYEMTNAYLGCNYPSPPRILPIIEKIVMHYLREELYQNTDTP-L 158 Francisella tul...
3FDD_A       165 SVNLFAVEGGTAAMAYIFESMKVNGLLKAGDKVAIGMPVFTPYIEIPELAQYALEEVAINADPALN-----WQYPDSELD 239 Pseudomonas dac...
WP_012058155 172 RFNIFAVEGATAAMCYIFDSLIANELLAPGDKIGLMVPVFTPYLEIPHLPRYNFEIVHIEATELTGdgthtWQYPESELN 251 Clostridium bei...
WP_011948813 173 EFNLFAVEGATAAMCYIFDSLIANELLQRGDRIALMTPIFTPYLEIPLIPRYNFEVVKISATETKEdgthtWQYPDEELE 252 Clostridium bot...
WP_011010163 169 KFKLFAVEGATAAMCYIFDSLIANELLQRKDKIAIMTPIFTPYLEIPQLPRYDLESIYIHASEINEegsytWQYPEEELN 248 Clostridium per...
EXY13887     176 KYDLFATEGGTAAMCYVFDSLQENFLLNKGDGIALMVPVFTPYIEIPQLRRYEFNVTEISADQMTTdglhtWQYKDEDID 255 Bacteroides fra...
WP_011989267 172 EFKLFSVEGATAAICYIFDSLIANELLHRRDKIAIMTPIFTPYLEIPVIPRYDFDLIRIMASESLEdsthtWQYPKSELE 251 Clostridium klu...
WP_004454813 171 DVEIFAVEGATAAMCYIFDSLMANELLKKGDTIALMTPIFTPYLEIPNLPRYDFKVVNINANEVDEkgahtWQYTKKELE 250 [Clostridium] d...
WP_011298857 165 EFDLFAVEGGTAAMTYLFNSIRENHLLKAGDTIALGMPIFTPYIEIPELNDYKLVELSVEADPGER-----WQYSNKELD 239 Cupriavidus pin...
BAC48742     284 KFDIYAVEGGTAAMCYLFKSLKANRLLLPGDTIALGTPIFTPYIEMTHLEDYDLKVVQIRAPQENK-----FQFTDDEIK 358 Bradyrhizobium ...
WP_010032119 159 EFDIFATEGGTAAMTYIFQSAKINGLLNAHDKIAMITPIFSPYLEIPELPEYNNPIVHIYADEKVY-----WQVTDKELE 233 Francisella tul...
3FDD_A       240 KLKDPAIKIFFCVNPSNPPSVKMDERSLERVRKIVAEHRPDLMILTDDVYGTFADGFQSLFAICPANTLLVYSFSKYFGA 319 Pseudomonas dac...
WP_012058155 252 KLKDSSIKALFVVNPSNPPSVAIKPESVKQLIDIVENYNPNLMIISDDVYSTFVNNYRSLMADLPYNTIGVYSFSKYFGV 331 Clostridium bei...
WP_011948813 253 KLRDSSIKALFVVNPSNPPSVAIKSDSINKIVQIVNESNPNLMIISDDVYGTFVDEFRSLVADLAFNTIGVYSFSKYFGV 332 Clostridium bot...
WP_011010163 249 KLKDPSIKALFLVNPSNPPSMAIHDKSKELLKDIVTNYNPNLMIISDDVYGTFVNKFQSLVADLPHNSIGVYSYSKYFGV 328 Clostridium per...
EXY13887     256 RLRNPQIKALFITNPSNPPSYTLSPETAARIVDIVKKDNPNLMIITDDVYGTFSPHFRSLMAELPQNTLCVYSFSKYFGA 335 Bacteroides fra...
WP_011989267 252 KLYDPGIKALFLVNPSNPPSVAIRSESIEYLVKIVKNKNPNLMIISDDVYGTFPDNFHSIVSALPFNSIGVYSFSKYFRV 331 Clostridium klu...
WP_004454813 251 KLRDKSIKALFVVNPNNPASIAMDETSCNNLIDVIENYNKDLMIISDDVYGTFVEDFSSLMSKLPYNTVGVYSYSKYFGV 330 [Clostridium] d...
WP_011298857 240 KLRDPKVKAFFLVNPSNPPSVRMSDESLEYLASIIEE-RPDLIILTDDVYGTFADNFVSLFAMCPKNTILVYSFSKYFGA 318 Cupriavidus pin...
BAC48742     359 KLEDPKIKAFFIVNPANPSGMGVSPETIAKLGNLVRTKRPDLMLLTDDVYGTFVHGFRSLLGELPLNTIGVYSYSKYFGC 438 Bradyrhizobium ...
WP_010032119 234 KLLDPTIKILCLVNPSNPPSVKISDLVLEKIAYIIDNHRSDLMIITDDVYATFSDDFESLFSKCAYNTLCVYSFSKYFGA 313 Francisella tul...
3FDD_A       320 TGWRLGVVAAHKENIFDLALGRLPESEKTALDDRYRSLLPDVRSLKFLDRLVADSRAVALNHTAGLSTPQQVQMTLFSLF 399 Pseudomonas dac...
WP_012058155 332 TGWRLGTISLYSENVFDKLLKNLPEDKKAELRQRYGDLSTTPDDIKFIDRIVADSRQVALNHTAGLSTPQQVQMAFFCTF 411 Clostridium bei...
WP_011948813 333 TGWRLGTIALYEGNVFDKLIRELSEEKKEALRKRYGALSTNPEEILFIDRIVADSRQVALNHTAGLSTPQQVQMAFFSVF 412 Clostridium bot...
WP_011010163 329 TGWRLGTLALYEDNIFDKLISELPSEKKEMVNKRYESLSTDPEKIPFIDRIVADSRQVALNHTAGLSTPQQVQMAFFSAF 408 Clostridium per...
EXY13887     336 TGWRDAVIALHEENIFDRMIAHLPEEQKTILNKRYSSLTLTPEKLKFIDRMVADSRQVALNHTAGLSLPQQTQMSLFASF 415 Bacteroides fra...
WP_011989267 332 TGWRLGTIALHKNNIFDKLLKALPENKKKSIKKRYEALSVNPGEIDFIDRIVADSRQVALQHTAGLSTPQQVQMAFFAAF 411 Clostridium klu...
WP_004454813 331 TGWRLGTFALHKKNVFDKKINDLTGELKKSVDKRYSDMSLNPSSLSFMERVVADSRLVALNHTAGLSTPQQVQMAFFSAF 410 [Clostridium] d...
WP_011298857 319 TGWRLGVIATHRDNVFDEKIAALPDAARKELHERYTSITTEPDKLKFIDRLVADSRTVALNHTAGLSTPQQVQMVLFSLF 398 Cupriavidus pin...
BAC48742     439 TGWRLGAIAIHEDNIFDKMIAKLPDDAVKALDKRYGPLTLEPRKLKFIDRIVADSRDVALNHTAGLSLPQQVMMSLFSLA 518 Bradyrhizobium ...
WP_010032119 314 TGWRIGTIALHKDNIFDKLISNLDDKKLDELDKHYSSLTTDSRTLKFIDRLVADSRSVALNHTAGISLPQQLQMGLFALS 393 Francisella tul...
3FDD_A       400 ALMDESDQYKHTLKQLIRRREATLYRELGT--PPQR--DENAVDYYTLIDLQDVTSKLYGEAFSKWAVKQSSTGDMLFRI 475 Pseudomonas dac...
WP_012058155 412 ALLDEENIYKKQTKDICKRRQKLLFKGLGL--DLRE--DPYDAAYYTEFDLLEWATCYYGSEFGEYLQINYKPVDILYKL 487 Clostridium bei...
WP_011948813 413 AILDKENKYKQLTQQICRRRQKLLYEGLGI--KFER--EENDASYYTEFDLLQWAHCNYGEDFGAYLEKNYKPVDILLRL 488 Clostridium bot...
WP_011010163 409 SLVDKENTYKNQTIDICHRRQKLLFEGLDL--PIKE--NPYDASYYAEFDLLQWALKNYGPEFANYLESNYKPVDVLYKL 484 Clostridium per...
EXY13887     416 AILDKENRYKNKMQEIIRRRLKALWDNTGF--SLVD--DPLRVGYYSEIDMLVWAKIFYGEEFVSYLKKTYSPLDVVFRL 491 Bacteroides fra...
WP_011989267 412 DLLDKEKKYRNLTNSICRKRKKLLFDGLGI--DLQK--NEYDASYYAEFDLLEWSEHHYGKEFGSYLKENYKPVDILFKL 487 Clostridium klu...
WP_004454813 411 ALIDKVDAYKKLNMSICHRRQKLLFEALEL--PINE--NKNNAAYYTQFDIEEWAKLNYGEDLFKFISKTASPVDVLYKL 486 [Clostridium] d...
WP_011298857 399 SLMDTPDNYKIAMKRLIRNRKAALYREIGIa-PEAD--DPNAVDYYTLLDIEALGGKALGPDFVKWVLASVEPNELLFRL 475 Cupriavidus pin...
BAC48742     519 EMMDAKKAYQAACMEIVNKRLWALLDGLGLadKLSP--NPNYDAYYGLIDFEFWARKNIGDEAVDYLKKHIHPLDLAFRL 596 Bradyrhizobium ...
WP_010032119 394 SLLDNQNIYRKEAKDLIRRRYNILYSSISP--KLQQslDENNVGYYTLLDLEELSYKIYDKDFSQWLIKNHSGPETLKIL 471 Francisella tul...
3FDD_A       476 ADETGIVLLPGRGFGSDRPSGRASLANLNEYEYAAIGRALRQMADELYAQY 526 Pseudomonas dacunhae ATCC 21192
WP_012058155 488 AEESAIVLLSGGGFKGPEWSIRISLANLNDDAYSRIGEALHKILDEYVNSW 538 Clostridium beijerinckii
WP_011948813 489 AEKSSIVLLGGGGFHGPEWSIRISLANLNDEAYSKIGKVLHNVLDEYVKEW 539 Clostridium botulinum
WP_011010163 485 AEESSIVLLSGGGFQGPEWSVRISLANLDDDAYSEIGTVLRKILEDFVHHW 535 Clostridium perfringens
EXY13887     492 ANETSLVLLNGGGFAGPEWSVRVSLANLNEKDYVKIGQGIKRILDEYAVKW 542 Bacteroides fragilis str. 1007-1-F #8
WP_011989267 488 AEKSSIVLLSGAGFYAPEWSIRISLANLNDESYSEIGHILHNILKDCLRDW 538 Clostridium kluyveri
WP_004454813 487 ANDYSVVLLSGNGFYGPEWSIRISLANLYDEAYTKIGKAIREILNGYIVEW 537 [Clostridium] difficile
WP_011298857 476 AEDAGVVLLPGRGFGTRHPSGRVSLANLNESDYAKIGRSIRKLFEEYVEKY 526 Cupriavidus pinatubonensis
BAC48742     597 AEAHGIVLLNGGGFDAPEWSLRVSLANLPDDVYDDIGRGVRSIARGYRDAY 647 Bradyrhizobium diazoefficiens USDA 110
WP_010032119 472 ATETGIVLLPGKGFDVLHPSARVSLANLREYDYRQIGISIRQQLDNLYSQY 522 Francisella tularensis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap