Conserved Protein Domain Family
TTQ_mauG

?
TIGR03791: TTQ_mauG 
tryptophan tryptophylquinone biosynthesis enzyme MauG
Members of this protein family are the tryptophan tryptophylquinone biosynthesis (TTQ) enzyme MauG, as found in Methylobacterium extorquens and related species. This protein is required to complete the maturation of the TTQ cofactor in the methylamine dehydrogenase light (beta) chain.
Statistics
?
PSSM-Id: 163503
View PSSM: TIGR03791
Aligned: 2 rows
Threshold Bit Score: 591.233
Threshold Setting Gi: 499798185
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_012753049  63 LTPEKVALGKALFFDPRLSRSGSVSCATCHNPSLGWSDGLTRAVGFGMVPLPRRTPPVLNLAWGTAFQWDGRADSLEAQA 142 Methylobacteriu...
WP_011478919  44 LTIEKAALGKTLFFDPRLSRDGSMSCATCHNPGMRWSDGRILPLRADGVEHARRTPTVLNSAWLTTLMWDGRATSLEDQA 123 Methylobacillus...
WP_012753049 143 RMPITAPDEMNMSMDLVVERLKAVPGYAPLFRNAFGSEEpIGARHVTAALATFQRTLVSGEAPFDRWALGDESAIGADAK 222 Methylobacteriu...
WP_011478919 124 ILPITTAHEMNFEMPLLLNRLKDVAGYAPLFARAFGDAE-ITEKRLTQALASFQRTLVSKLAPFDVWVEGDESAMSERAK 202 Methylobacillus...
WP_012753049 223 RGFALFTGKAGCAACHSTWRFTDDSFHDIGLKAgNDLGRGKFAPPSVTAMRYAFKTPSLRDLRMEGPYMHDGQLGSLEAV 302 Methylobacteriu...
WP_011478919 203 RGFAVFKGKARCATCHSSWRFTDDSFHDIGLPS-LDPGRGARVPPQVTIMQHAFKTPTLRDLPRNGPFMHDGSMHSLDEV 281 Methylobacillus...
WP_012753049 303 LDHYIKGGEKRPSLSFEMKPFEMSERERRDLVAFLETLKAEPAAITLPQLP 353 Methylobacterium extorquens
WP_011478919 282 IRHYEQGGLQRPSISAEMKRFELTETEREYLIEFIHTLDGGLLDIEPPQLP 332 Methylobacillus flagellatus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap