Conserved Protein Domain Family
marine_sort_RR

?
TIGR03787: marine_sort_RR 
proteobacterial dedicated sortase system response regulator
This model describes a family of DNA-binding response regulator proteins, associated with an adjacent histidine kinase (TIGR03785) to form a two-component system. This system co-occurs with, and often is adjacent to, a proteobacterial variant form of the protein sorting transpeptidase called sortase (TIGR03784), and a single target protein for the sortase. We give this protein the gene symbol pdsR, for Proteobacterial Dedicated Sortase system Response regulator.
Statistics
?
PSSM-Id: 163499
View PSSM: TIGR03787
Aligned: 7 rows
Threshold Bit Score: 421.854
Threshold Setting Gi: 500111087
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011398126   3 RRIALVEDEPLIRANYSEALKKHGYQVETYDSRPSAMERFRVQLPDLVIIDVGLGSDVEGGFELCREVRGLSSQVPIIFL 82  Hahella chejuensis
WP_011072225   2 KRIAIVEDEAAIRENYKDVLQQHGYSVQTYADRPSAMLAFNTRLPDLAIIDIGLGNEIDGGFMLCQSLRAMSNTLPIIFL 81  Shewanella onei...
WP_011327326   2 KKIAIIEDEPAIRENYTEMLSAQGYQVTGYANRSSAEAAFKNALPDLAIVDIGLGNEIDGGFLLCQTLRSLSKTLPIIFL 81  Pseudoalteromon...
WP_011044726   3 KRIAIVEDEAAIRENYADVLRSQGYQVQTYADRSSATQAFNLRLPNLVILDIGLNDEYDGGFVLCQQLRAKSATLPIIFL 82  Colwellia psych...
WP_011576627   7 QRIALVEDDLAIRENYAAALKKQGYEVICYANRRQAEQGFAQRLPDLAIIDIGLQDEIDGGFMVCQQLRSLSKTLPIIFF 86  Pseudoalteromon...
WP_011467498   3 RHIVIVEDEEAIAQNYCDALRRQGYKVTHYRTRPEATEAFAARLPDLAIIDVGLGEEIEGGFDLCRDLRSRAPELPIIFL 82  Saccharophagus ...
WP_011787092   3 KHIVLIEDEAGIRDNYRAAFERRGYRVSTYGDRPAAWQVLRQSLPDLAIIDVGLGEEAEGGFTLCQDLRSLSATLPIIFL 82  Marinobacter
WP_011398126  83 TARDSEFDQISGLRLGADDYLTKDISIPYLLTRIVALFRRLDALQAAnQKQDELITRGQLKLNIDRMQAFWNDEPIMLTV 162 Hahella chejuensis
WP_011072225  82 TARDSDFDTVCGLRLGADDYLSKEVSFPHLTARLAALFRRSELAASQ-TPQENLLERGPLTIDANRMQVYWNQIAIELTV 160 Shewanella onei...
WP_011327326  82 TARDSEIDTVCGLRMGADDYLTKDISLAHLAARIGALFRRMEALKQP-ADENALITRGPLTLDTQRMQVFWQQLLVDLTV 160 Pseudoalteromon...
WP_011044726  83 TARDNDFDTVSGLRIGADDYLTKDISLPHLTARISALFRRQEALKKP-INDDHITRSGALTVDSQRMSITWQNSSIDLTI 161 Colwellia psych...
WP_011576627  87 TARDNDYDTICGLRMGADDYLTKDISLPHLLARIAALFRRVALLNQP-QLSEDVIQTGELSIDSKRMTVSWQTQGIELTV 165 Pseudoalteromon...
WP_011467498  83 TARDSEFDVVSGLRLGADDYLTKDISQVHMLARITTLFRRIDALQKP-LAKETNIQRGSLTMNMDRMTAHWNDIAVDLTI 161 Saccharophagus ...
WP_011787092  83 TARDSDIDSVHGLRLGADDYVTKDMSLEHLLARITALLRRAEAWAEAlQKPDDILTRGKLTLNVDRMTVAWQGQPVDLTV 162 Marinobacter
WP_011398126 163 TEFWIVHALARHPGHVKNRTQLMDAANAVLDDSTITSHIKRIRKKFQAVDPDFRAINTAYGMGYRWDS 230 Hahella chejuensis
WP_011072225 161 TEFWMVHALAKHPGHVRSRHELMQEAKIFVDDSTITSHVKRIRKKFMAAAPEFDCIDTVYGMGYRWDS 228 Shewanella oneidensis
WP_011327326 161 TEFWMLHSLAQRPGHVKSRNELMSDAKIYVDDSTITSHVKRIRKKFIALDSNFDCIDTVYGMGYRWEQ 228 Pseudoalteromonas haloplanktis
WP_011044726 162 TEFWLVHALAKNPGHVKNRTQLMTDSKIYVDDSTITSHIKRIRKKFMLHDNNFDCIETVYGMGYRWLS 229 Colwellia psychrerythraea
WP_011576627 166 TEFWMLHAIAKYAGHVKSRQQLMDESKMVVDDSTITSHIKRIRKKFQQVDSQFDRIETVYGMGYRWKN 233 Pseudoalteromonas atlantica
WP_011467498 162 TELWIVHALALHPGHVKNRQQLMDAANVVLDDNTITSHVKRVRKKFKAIDDNFDAIQTAYGMGYRWLN 229 Saccharophagus degradans
WP_011787092 163 TEFWMLHALVQHPGHVRSREQLMEAASTVLDDNTVTSHIKRIRRKFSQLDDQFDGIQTAYGMGYRWNA 230 Marinobacter
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap