Conserved Protein Domain Family
marine_sort_HK

?
TIGR03785: marine_sort_HK 
proteobacterial dedicated sortase system histidine kinase
This histidine kinase protein is paired with an adjacent response regulator (TIGR03787) gene. It co-occurs with a variant sortase enzyme (TIGR03784), usually in the same gene neighborhood, in proteobacterial species most of which are marine, and with an LPXTG motif-containing sortase target conserved protein (TIGR03788). Sortases and LPXTG proteins are far more common in Gram-positive bacteria, where sortase systems mediate attachment to the cell wall or cross-linking of pilin structures. We give this predicted sensor histidine kinase the gene symbol psdS, for Proteobacterial Dedicated Sortase system Sensor histidine kinase.
Statistics
?
PSSM-Id: 163497
View PSSM: TIGR03785
Aligned: 8 rows
Threshold Bit Score: 827.075
Threshold Setting Gi: 500111088
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011576626  28 IRLKLLALSIFLFAIPWLGYQYVWELESYLRIGQEQTMVGTARAVATALHERPALFDTQSAYLTDVKPGTDLYAHKIHDP 107 Pseudoalteromon...
WP_011865588   8 LRTKVAVLSLFLLCLPWLGYQYVWEMEKYLRHGQEKTLEGTTQALATALHERPKLFDKQASFLSQVKKGRDLYAYPLTGP 87  Shewanella loihica
WP_011626397   8 LRTKVIGLSLFLLCLPWLGYQYVWEMEKYLRHGQERTLEGTTQALATALHERPKLFDGQASFLKQVEKSRDLYAYPLAGA 87  Shewanella sp. ...
WP_011327325   6 LRSKFILLSCFLFLLPWLGYEYVWEMEKFLRQGQEKTLVGTTRALATALHERPALFDQQTSFLDQVVKGRDLYAYNLKNP 85  Pseudoalteromon...
WP_011044725  13 LRSKLLLLSSFLFVIPWFGYQYVWEMEKYLRFGQEQTLVGTARALATALHERENLFNNQASFLPNVEQGKDLYGYKLTEA 92  Colwellia psych...
WP_011467497   3 LRKQLFFVSLITLTLPWAGCQYVKEMEQTLRTGQSEALTATAMAAAARLSSDPAAV-MQLQQLGTPAGLTPLYAHPMATA 81  Saccharophagus ...
WP_011398127   3 LRRQLILIACVMLLLPWAVIQFAKQIEQSLRESQQQNHIQLAGFIASLL--RPE-WPTPAS-----IGGRILNVRQYDTP 74  Hahella chejuensis
WP_011787093   3 LKRQLLLASLLMLLVPWAGLRFVLELDSALRQQALQQLQAQGARLADVAGDR--LLDTPVA-----TDQGAIYAGSTDQA 75  Marinobacter hy...
WP_011576626 108 IRLDGKLDDWLDYQHLSLEYG---RahlldyLNDSDDYQPSSLHFRHMVGQFGEYLYAMFEVTDERVLLRAKNSLRVDRN 184 Pseudoalteromon...
WP_011865588  88 IHLDGKLGEWASNRHRAVTYGadhQ------LFKADDGKPLNISFTHMVGKYAGYLYGYFEVTDPKVIYRGTNSLRIDNN 161 Shewanella loihica
WP_011626397  88 ILLDGKLNEWQEYQHRFIQYG---Ean---lIMRADPSTPLTLSFTHMVGQYDGYLYAFFQVVDPNVVFRGKNALSVDRN 161 Shewanella sp. ...
WP_011327325  86 IQLDGKLTDWESYQALFWQYD---Kry---lQKTDNKHQASDLSFEHMVGKFDNYLYALFKVTDNQLVYRPKNSLSITNN 159 Pseudoalteromon...
WP_011044725  93 VNLDGLPNDWPDFNQRTHFYN---Q------QQQLFANEPLSLNFKASVGKYNNYLYLFFQVVDNRLIFRGENTRSITNN 163 Colwellia psych...
WP_011467497  82 VVPDGYDDEWVTAG-----------------LARQGLAAPSGEKAQIVAGSYQRSLYLFLRSYNNPKQYYSPSQRSPIES 144 Saccharophagus ...
WP_011398127  75 VYLDGYQDDWAE-------------------IPALSGPKPDSIRAVKAATD-GQDLYLLVAANDASIQYQQPSARS-QPA 133 Hahella chejuensis
WP_011787093  76 ITIDGYGHEWPGFDEGDQPAP----------WQTAGKTSPLRWQASHD----DQFLYLLIQRLDQGLALYNP-ARPDQAH 140 Marinobacter hy...
WP_011576626 185 DYLQIAMTGPD------GSFKRYVVAPQEAGWVNAYLLSESVDSmrpvS----LETQIQGRWLNTAKGYNVELRFPLAMM 254 Pseudoalteromon...
WP_011865588 162 DHLAIATLAPD------GQFRRYIVATIRDGWISAFELPADPRKsqpvT----PEVRIQGKWLKTEKGYNIELRMPLEMV 231 Shewanella loihica
WP_011626397 162 DHLSIATLAPD------NKFKRYIVATTQPGWISAFELPANPKQ----TvpvtPEVRIQGQWATTDVGYNIELRIPLDMV 231 Shewanella sp. ...
WP_011327325 160 DHLKIGLKTPD------GQFNRYIIAPRQDGWVNAFNADS---K----V----PFTKIQGYFSSTAAGYNIELRFPISML 222 Pseudoalteromon...
WP_011044725 164 DHLALSFSDTN------NKLNRFIISNKKAGWISAFALTDDETAi--pA----PAPQIQGHWLPTSQGYNIELRVPLDNL 231 Colwellia psych...
WP_011467497 145 DHLRIKLRNEL------GQEQTLLVYTSVPGRASVDRLIENNRT----V----AEHKVICHWLEWQDGYHIELELPLTWA 210 Saccharophagus ...
WP_011398127 134 DHFELITGYLA------GGKAVTMLETEGPGQIKARLA----------G----SWSSVHGMWQEDGPGFILELRIPLASL 193 Hahella chejuensis
WP_011787093 141 ERLELWLQAPArelgthNQGQRWFIRAVAPGDVPVYRAEPAQ------A----RDHRLQASWQDKGASWELELKLPLPSP 210 Marinobacter hy...
WP_011576626 255 SSKIAFAITDVDDPQTREIRYRIGTANPNKSDTLGTVLVPSPEIENILKGLKYSNARVWVIDKHKRVLARSGNIHKSVGL 334 Pseudoalteromon...
WP_011865588 232 GSKLGFAIVDVNDRKARNVEAIVGTSATDDVTKLGTVLVPSPEIESIIKGMSHNSSRIWVVDRHGRVLAKSGDIYSSTNV 311 Shewanella loihica
WP_011626397 232 GSKLGFAISDVNDSKYRDITSVVGTSALDTVDKLGTVLVPSPEIENIIKGMSHYSSRIWVVDKHGRVLAKSGDIRDSNSV 311 Shewanella sp. ...
WP_011327325 223 GNKLGFAIIDVDNKEPLLEPKIMSTSNLNNPSDLGSVLVPSPEINRILKGMGHSGSRIWVVDKHHRVLAQSGSIHHADGV 302 Pseudoalteromon...
WP_011044725 232 GDNIAFAFYDVDKTNSEAVSA-IGSADPSKEESLGTIVVPSPEIERIVKGMRYTNSSIWVVDQHHRVLASAGSLNSASGV 310 Colwellia psych...
WP_011467497 211 KGGIEVYLTQALASDASK-QALLSNRQNNQTALIAPLITPSEILANELAIFSRTGVQLHVASSGVKRLASTGNLNAPA-- 287 Saccharophagus ...
WP_011398127 194 QDGFSLRWVDIDKSAAWVFNRNTLNVLGSDAEPMLLNFAPPALIHKAQELTPEYTRLRLTDAQGATLLEYDNDLMRYIGM 273 Hahella chejuensis
WP_011787093 211 GSRLGFQ----------------ATREGQPNNNTGTTLAPPPLLVQQDNRLEHLLKSQISPGQQATVLE----------- 263 Marinobacter hy...
WP_011576626 335 Ss-sAYSSNKDQQASWWQSIEQKWLLPLYYQILTKP-PADFIDDLQDAYALQG------QDINQALMGTPASLWRLSPDN 406 Pseudoalteromon...
WP_011865588 312 W---AQTATEQTPDTFWGRFKQQFLHPLYYRILTTP-PKHFVDSLKDSTVLEG------SHIRKALAGQFGSTWRLSPDG 381 Shewanella loihica
WP_011626397 312 W---TRTLDDENSNSMWQRFQRDYLHPLYYKILTKP-PKDFIDSLQDSTELDG------SHIQKALAGQQSSTWRLTPDN 381 Shewanella sp. ...
WP_011327325 303 W---ADGLANQAPETWWQQFEQNYLHPLYYKILTRP-ENEFLDTLHDVAAMQG------SHLAKALKGQPASSWRLTPDS 372 Pseudoalteromon...
WP_011044725 311 WhakEKQPKEGEKNSLWYQFKQQLLLPLYYKILTKP-STDFIDQLYDAQHLQG------SHIVNALSGKATSQWRLTTDK 383 Colwellia psych...
WP_011467497 288 ----SKKLKEQHGLISW----------LYTLALGND-KLPELDNVQTSGQFET------PEVSLALQNTSAQG--VYQKG 344 Saccharophagus ...
WP_011398127 274 Q-----------DDVWR----------MAMRRLVRW-AVDGVSQAEESRPIAA------D--------APRSTWDASATS 317 Hahella chejuensis
WP_011787093 264 ------------PGSWI----------LAHSRVAAPaPASVFDDLSPGQILEQislnalSGLIRLYQPEPMHLPKENNRQ 321 Marinobacter hy...
WP_011576626 407 KAVILSAAH-------PIFIDE----NVMG--AVVVEQTTNGIRTLRNLALEKLFHVILAVMGLGTLALFLFASRMSFRI 473 Pseudoalteromon...
WP_011865588 382 KAVILAAAS-------PIWIDD----TVMG--VVIAEETTHGIRTLRNKALEKLFNVILTVMSMGTLALFFFASSISSRI 448 Shewanella loihica
WP_011626397 382 KAVVLAAAS-------PIWIDN----NVMG--AVVAEETTHGIRTLRNRALEKLFNVILTIMSMGTLALFFFASSISNRI 448 Shewanella sp. ...
WP_011327325 373 KAVILSAAY-------PIWIQD----KVIG--AVIAEETTNGVRTLRNKSLEKLFNVILAVMLIGTVTLFFFASRISSRI 439 Pseudoalteromon...
WP_011044725 384 KALVLSAAY-------PIFINN----QVKG--AVIVEETTNGIRSLRNRALEKLFTVILAIMSLGALTFILFASRISSRI 450 Colwellia psych...
WP_011467497 345 AKRLLRVAV-------PILANGdknaQPLG--VVIADQNADSLATMTNSAFNRLIMYSLGTVFIAAFALIIYASWISMRI 415 Saccharophagus ...
WP_011398127 318 ELANLITRY-------PVKSETg---ELLG--WVQLEQRTPQIAAVANDALFAAVGGSVALLIIIMLILFGYASWLSWRI 385 Hahella chejuensis
WP_011787093 322 EMPRLPDNGlvrhddgSVWLATr--hELFGgrILLLEQSLDQLLTLSGSTLGSVLARSLLIILALMLVLLGYASWLSWRI 399 Marinobacter hy...
WP_011576626 474 RKLRNQTEAAIDQHGKIIGTIPSATAGDEIGDLANTFNIVLSKLGQYNTYLQNMSARLSHELRTPVAIVKSSLENLQLSQ 553 Pseudoalteromon...
WP_011865588 449 RKLRDDAEQAIDSQGRIRKAIVGSKVRDEIGDLSRSFASIVGRLSQYTHYLENMSSRLGHELRTPVAVVRSSLEHLNSQD 528 Shewanella loihica
WP_011626397 449 RKLRDEAENAIDSQGRVRNHLKPSKARDEIGDLSRSFASIVGRLGQYTHYLENMSSRLSHELRTPVAVVRSSLEHLNLQT 528 Shewanella sp. ...
WP_011327325 440 RRLRDTAEQAIDAQGRVTGSINYSDANDEIGDLSRSFANIVSRLGGYTNYLENMSSRLSHELRTPVAVVRSSLENLQMQP 519 Pseudoalteromon...
WP_011044725 451 RQLSSQAELAIDKQGRIIGQMQASNSNDEIGDLSRSFTTAVNRLSEYNHYLENMSSRLSHELRTPIAVVKTSLDNLSLLE 530 Colwellia psych...
WP_011467497 416 GRLSQAAVNAVSETGKISDDFPILNSKDEVGDLSRSFGQLLARLREYTHYLRTLSSKLSHELRTPLAIVRSSLDNLEHVK 495 Saccharophagus ...
WP_011398127 386 THLSKDIVSALDTETKFSGRFQASRLPDELGDLSRSFSEMLTQLRSYSEYMESFASKLTHECRTPLAIVSSSLQLLESAA 465 Hahella chejuensis
WP_011787093 400 TRLQALVEASVDDDGRILAAIPSPRSRDELGQLQQHFAQMVARLQNYNQYLESFSRRLSHELKTPVAVVRSSLENLAQGV 479 Marinobacter hy...
WP_011576626 554 QTDEDAQ-----YIERAQLGIKRLSTILNNMSEATRLEQAVQSNEREDFDMNALLSGYVEGYRMTYASHKFAYVNEAGDV 628 Pseudoalteromon...
WP_011865588 529 LPPQHQK-----YVDRAHEGVSRLNMILNNMSEATRLEEALTDAEVDNFPLSKVISGCMQGYQMTYANQVFELEIDKEPM 603 Shewanella loihica
WP_011626397 529 LDKDTQK-----YVDRAQEGVSRLSMILNNMSEATRLEQSLTQADVAKFPLSQVVSGCMQGYQMTYPEQQFSVKVPEQPL 603 Shewanella sp. ...
WP_011327325 520 QSELSQK-----YLDRASEGVERLGKIITTMSEATRLEQSIQSNEPEPFDLQKVISGCMQGYQLTYPKQLFTLDICQTAL 594 Pseudoalteromon...
WP_011044725 531 TQQAQTGktnnpYIERAQTGIKTLNLILTNMSEATRLEQMLSSTEKIDFDLQQVVKGCISGYQQIYPTMQFILNIDVKAL 610 Colwellia psych...
WP_011467497 496 LSKEAKV-----YAERAREGTLRLSSILNSMSAASRVEQAISGADIEDIPANELLSSLKAAYEDVYKHVDFKLNIRDDGQ 570 Saccharophagus ...
WP_011398127 466 DEQEKQE-----YLGRARAGAERISALLTAMRQASRLEATIQTQSVEAFDLSELISELQQSYRPLVEPRRLELELPETPM 540 Hahella chejuensis
WP_011787093 480 AENERQQ-----YLERAATATERLRRILHSMSEAARLEQSFEDTEKEPFDLARVLAEATSAYQQLDTGHRIVYSGPTSDC 554 Marinobacter hy...
WP_011576626 629 -----LLLGSGDLFGQMLDKIIANALEFSPEHTL-IFIRLSLKESKYLLTIENDGPPLPNDMEDKLFDSMVSVRP----- 697 Pseudoalteromon...
WP_011865588 604 -----TMRGVPEYIAQLMDKLIANAIEFSQSDTP-IKVSLKAKGRQALLSVSNLGPSLPANMGEQIFESMVSVRA----- 672 Shewanella loihica
WP_011626397 604 -----MMQGVPEYIAQLMDKLIANAIEFCHQGSA-IEVTLTQVGKQATLLISNLGPQLPVDMSEQIFDSMVSVRI----- 672 Shewanella sp. ...
WP_011327325 595 -----PMQGAPEFIAQLLDKLINNAIEFSHAEKP-ISVSLKQNDSAAILTVGNYGPLLPVGLTEHIFDSMVSVRS----- 663 Pseudoalteromon...
WP_011044725 611 nastfLLHGSPEHIVQLLDKVVSNGVEFSQDNIItIELKKSSNKHNAELLISNNGILLPEQLSESLFDSMVSLRDknqna 690 Colwellia psych...
WP_011467497 571 d---fTLRGSGELLVQMLDKLVDNAADFCPQQGL-IELGLYRNNNHIMITVRNDGPPLPSHMHGQLFDSMVSVRD----- 641 Saccharophagus ...
WP_011398127 541 -----VADISAELIAQAVDKLLENARDFTKPDGV-IYIGVEETKQERWIFVENEGDPIPEDIKEKLFTPFMSVRQ----- 609 Hahella chejuensis
WP_011787093 555 -----VMNGSPEMLVQMLDKLVDNARDFTPEGGG-IDVCLHIHDGHYLIEVFNEGSRLPDHDGVDIFGAFVSQR------ 622 Marinobacter hy...
WP_011576626 698 EHATSQPHLGLGLFIAKAIAQFHGGDIQIENRYSeaD---EHLGVRVSLV 744 Pseudoalteromonas atlantica
WP_011865588 673 QKAQDKPHLGLGLYIARLITDFHKGSIRAENLMQ--DgqaTGVVIHIRLP 720 Shewanella loihica
WP_011626397 673 NQAQDKPHLGLGLYIARLVTEFHQGKILARNRSE--N---DGVDILVTLP 717 Shewanella sp. MR-7
WP_011327325 664 QQMQQQPHLGLGLYIVRLVCDYHNASVTAKNNQQ--G---DGVVFTVSLP 708 Pseudoalteromonas haloplanktis
WP_011044725 691 QNKQVVPHLGLGLYISRLICQFHQGNISAYNHQN--P---AGVTVHISLP 735 Colwellia psychrerythraea
WP_011467497 642 KTDERQHHLGLGLYIVRLIVDFHRGEVQGYNIPD--N---SGVIFEIKLP 686 Saccharophagus degradans
WP_011398127 610 DGGQEL-HLGLGLVIVKLIAEFHQARIKVENTAR-------GVRFAIGLP 651 Hahella chejuensis
WP_011787093 623 SGAHDG-HLGQGLLIVRLIADYHGGRVEARNQHQ--Sg-iDGVCFRVIIP 668 Marinobacter hydrocarbonoclasticus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap