Conserved Protein Domain Family
Bac_Flav_CT_G

?
TIGR03783: Bac_Flav_CT_G 
Bacteroides conjugation system ATPase, TraG family
Members of this family include the predicted ATPase, TraG, encoded by transfer region genes of conjugative transposons of Bacteroides, such as CTnDOT, found on the main chromosome. Members also include TraG homologs borne on plasmids in Bacteroides. The protein family is related to the conjugative transfer system ATPase VirB4. [Cellular processes, DNA transformation]
Statistics
?
PSSM-Id: 163495
View PSSM: TIGR03783
Aligned: 6 rows
Threshold Bit Score: 1724.29
Threshold Setting Gi: 492526584
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_005874655   1 MRNIRKKCELEEKFPLLAIENGCIVSKDADITVAFSLELPELFTVTSPEYAAMHAAWHKAVKVLPVYSILHKQDWFIRES 80  Porphyromonas g...
WP_011107104   1 MRNILKATTLENKFPLFTVENGCIVSKDADITVAFRVELPELFTVTAAEYEAIHSAWNKAVKVLPDYSIVHKQDWFIKEN 80  Bacteroides
WP_012457210   1 MRNLLKTTTLENRFPLLAVEEGCILSKDADITVAFRVELPELYTVTSAEYAAIHSSWVKAIKVLPTYSVVHKQDWFVKEG 80  Porphyromonas g...
WP_010992657   1 MRNVMKATTLESKFPLLAVENGCIVSKEADVTVAFRVELPELFSVTGSEYEAVHSAWHKAVKVLPEYSIVHKQDFFIEEK 80  Bacteroides fra...
WP_012025040   1 MRNSSKTATLESRLPLLAVEQNCIISKDGDVTACFAVSLPELFTAGSADYEAIHSAWHKAVKTLPDFTVVHKQDWYVKEN 80  Flavobacterium ...
WP_008675208   1 MRNVLKAETLERRFPLLSVENGCIVSKDADLTVAFEVELPELYTVTEDEYETMHSSWIKAMKVLPEHSIVCKQDWFIQET 80  Bacteroidales
WP_005874655  81 YRPELEKDDLSFLDRSYERHFNERPFLHHSVYLCLTKTTKQHMAQRSDFSTLCRGTLLPKEVRERDAVLKFLEAVDQFER 160 Porphyromonas g...
WP_011107104  81 YAPDIQKDDLSFLSRSFERHFNERPFLNHTCYLFLTKTTKERSRMQSNFSTLCRGFLVPKEIKDKETVTKFLEAVGQFES 160 Bacteroides
WP_012457210  81 YRPDLQKEDMSFLSRSFERHFNERPFLNHACYLFLTKTTKNRNRQQSNFSTLCRGHIIPKEVRDKDTARKFLEATEQFER 160 Porphyromonas g...
WP_010992657  81 YRPETDRDDLSFLSRSFERHFNERPFLNHFCYLFLTKTTKARSRQESTFSTLCKGRLVPKEIEDRETVTRFLEAVGQFEK 160 Bacteroides fra...
WP_012025040  81 YNPNMEGEEQSFLARTFERHFNERPFLNHCCYLFLTKTTRERMRMQSNFSSLCRGTLIPKEVRDPEAIRRFMETVAQFER 160 Flavobacterium ...
WP_008675208  81 YRSKSDGEEQSFLTRSYELHFNERPYLNHRCYLFLTKTTRERSRQRSDFSTLCRGFLLPREITDKDTAARFLESVEQFER 160 Bacteroidales
WP_005874655 161 IINDSGYMRLRRLSADEIAGTDDKRGLLDRYLSLRDDA-AGTLEDLRLGADEVRIGDQILCLHTLSDTDDLPAAVATDGR 239 Porphyromonas g...
WP_011107104 161 IMNDSGFITLTRLTSDEITGTKETAGIVEKYFSLSQTD-TTTLKDIQLNAGDMRIGDDILCLHTLSDAEDMPGKVGTDTR 239 Bacteroides
WP_012457210 161 IMNESGFIRLSRLTDEEIIGTAETPGLIEKYFSLSLSD-TTVLEDIDLKADQMRIGDKRLCLHTLSDTEDLPGLVGTDMR 239 Porphyromonas g...
WP_010992657 161 IMNDSGFVTLRRLTTDEITGTETAAGIVEKYLSLSQHD-TTVLKDIQLNPEEMRIGDDILCLHTLSDTEDLPGKVATDSR 239 Bacteroides fra...
WP_012025040 161 ILNDSGLIRLNRLTEEDLTGADHRQGILEQYLTLSKEE-GASLEDIALGAEQVRVGSKRLSLHTLSDTDDLPAAVASDTR 239 Flavobacterium ...
WP_008675208 161 IMNDSGHIRLRRLETDEITGTKERPGLVEKYLSLSLEDeSAVLQDICLKPGRMRIGDKRLCLHTLSDTEDLPGKLSTDMR 240 Bacteroidales
WP_005874655 240 YERLSTDRSDCRLSFAAPVGLMLPCNHIYNQYLFIDDSEENLKRFEKQARNMLSLARFSRSNQINREWIEEYLNVAHSQG 319 Porphyromonas g...
WP_011107104 240 YEKLSTDRSDCRLSFASPVGVLLSCNHIYNQYIFIDDHTENLKQFEKMARNMHSLSKYSRANQINKSWIEEYLNEAHSQG 319 Bacteroides
WP_012457210 240 YERLSTDRSDCRLSFAAPVGLLLPCNHIYNQYVLIDDSAENLQRFEKSARNMHSLSRYSRSNQINKQWIDEYLNEAHSFG 319 Porphyromonas g...
WP_010992657 240 YERLSTDRSDCRLSFAAPVGLLLDCNHCYNQYIFIDDHGENLKRFEQTARNMHSLSRYSRSNQINKAWIEEYLNEAHSKG 319 Bacteroides fra...
WP_012025040 240 YEKLSTDRSDCRLSFAAPVGLLLGCNHIYNQYLFLDSSEENLQKFEKSARNMHSLARYSRANQINREWIEKYLNEAHSLG 319 Flavobacterium ...
WP_008675208 241 YERMSTDRSDCRLSFAAPVGLLLPCNHIYSQYVFIDNAQEILQMMEKNSRNMLSLSRYSRSNAVNQEWTEMYLDEAHTKG 320 Bacteroidales
WP_005874655 320 LASIRAHFNVLAWSDDREELRQIKNDVGSALALMECRPRHNTTDTATLYWAGMPGNAGDFPSEETFYTFIEPALCFFTAE 399 Porphyromonas g...
WP_011107104 320 LISVRCHCNIMAWSDDRDELKHIKNDVGSQLALMECKPRHNTTDTPTLFWAGIPGNQADFPAEESFYTFIEQALCLFTEE 399 Bacteroides
WP_012457210 320 LTSVRCHCNVLAWSEDEEELRRIRNDVGSQLALMECKPRHNTVDVPTLFWAGIPGNEADFPAEESFYTFIEQAVCFFNEE 399 Porphyromonas g...
WP_010992657 320 LTSVRCHCNVMAWSDDREELRRIKNEVGSQLALMECKPRHNTVDVPTLFWAAIPGNEGDFPFEESFYTFIPQALCFFTEE 399 Bacteroides fra...
WP_012025040 320 LSSIRAHFNIMAWSDDPAELKQLKNDCGSALALMECKPRHNTADAATLYWAGMPGNAGDFPCEESFYTFIEPALCLFTQE 399 Flavobacterium ...
WP_008675208 321 LLPVRCHCNVIAWAEDADEFRRVRNDTGSQLAMMECTPRYNTIDMPVLYWAGIPGNAGDFPAEESFYTFLEQAVCLFSGE 400 Bacteroidales
WP_005874655 400 TNYRSSLSPFGIKLSDRLTGKPLHLDISDLPMKRGIITNRNKFVLGPSGSGKSFFMNHLVRQYYEQGTHVLLVDTGNSYQ 479 Porphyromonas g...
WP_011107104 400 TNYKSSLSPFGIKMVDRVTGKPLHIDISDLPMKKGIITNRNKFILGPSGSGKSFFTNHMVRQYYEQNAHVLLVDTGNSYL 479 Bacteroides
WP_012457210 400 TNYRDSLSPFGIKMADR-SGKPIHLDISDLPMKKGITTNRNKFILGPSGSGKSFFTNHLLRQYWEQNTHIVLVDTGNSYQ 478 Porphyromonas g...
WP_010992657 400 TNYKDSLSPFGIKMADRMTGRPLHLDISDLPMKKGVISNRNKFVLGPSGSGKSFFMNHLVRQYYEQNSHIVLIDTGNSYQ 479 Bacteroides fra...
WP_012025040 400 TNYRSSPSPFGIKMADRLTGRPIHLDISDLPMKRGIITNRNKFILGPSGSGKSFFTNHMVRQYYEQGAHVLLVDTGNSYQ 479 Flavobacterium ...
WP_008675208 401 TNYRNSPSPFGIRMADRQNGIPVHVDISDLPMKRGIITNRNKFILGPSGSGKSFFTNHLVRQYYEQGTHILLVDTGNSYQ 480 Bacteroidales
WP_005874655 480 GLCSLIHRKTKGEDGIYFTYTEEEPISFNPFYTDDGVFDVEKKDSIKTLLLTLWKSEEEKISKTESGELGSAVSAYIRLI 559 Porphyromonas g...
WP_011107104 480 GLCEMINRKTHGEDGIYFTYTTENPIAFNPFYVEDGVFDIEKKESIKTLILTLWKRDDEAPTRAEEVALSNAVSSYIELI 559 Bacteroides
WP_012457210 479 GLCEMIRHKTQGEDGVYFTYSDESPISFNPFYTTDKVFDVEKRESIKTLLLTLWKKDNEPATRSEEVALSNAVSLFIERI 558 Porphyromonas g...
WP_010992657 480 GLCELIHRKTKGEDGIYYTYTEEKPISFNPFFTDDYKFSVEKKDSIKTLLLALWKGEDEKVTKTESGELGSAVSAYIRRI 559 Bacteroides fra...
WP_012025040 480 GLCGLINSRTRGEDGVYFTYTEDNPIAFNPFYTDDKVFDIEKRESIKTLIMTLWKRDDEPPTRSEEVALSNAVNGYIELI 559 Flavobacterium ...
WP_008675208 481 GLCRMIHDRTRGEDGIYITYEEDNPIAFNPFYTDCGLFDVEKRESIKTLILTLWKREDEAPKRSEEVALSGAVNAYIRMI 560 Bacteroidales
WP_005874655 560 GSDRGITPSFNTFYEFMRDTYRPELENREIKVSreDFNIDNFLTTLRQYYRGGRFDFLLNSDKNIDLLSKRFIVFEIDAI 639 Porphyromonas g...
WP_011107104 560 TKDSSVTPCFNTFYEYVKNDYRAHLQEKNVREK--DFDIDNFLNVLEPYYKGGEYDYLLNSDKELDLLHKRFIVFELDNI 637 Bacteroides
WP_012457210 559 KTDDGIVPSFNSFYEYLTTDYSALLREKKVREK--DFDLANFLNVLEPYYKGGEYDYLLNSDKQLDLLNARFIVFEIDSI 636 Porphyromonas g...
WP_010992657 560 QQNRDIAPSFDTFYEYMLNDYRKELAARDIKVSreDFNIDNFLTTLRQYYKGGRYDFLLNSNENIDLLHKRFIVFEIDAV 639 Bacteroides fra...
WP_012025040 560 R-DNGLAPSFNGFYEYVKGDYHEILKEKQVREK--DFDIANFLNVLEPYYRGGEYDYLLNSDRQLDLLAKRFIVFEIDAI 636 Flavobacterium ...
WP_008675208 561 SENQGIKPDFNGFYEFVADDYRRMIEEKKVREK--DFDIDGFLNVLAPFYKGGDYDFLLNSDKELDLTGKRFIVFELDNI 638 Bacteroidales
WP_005874655 640 KENRELFPVVTIIIMEAFINKMRRLKGVRKQLIVEEAWKAIASANMADYLKYMYKTVRKYFGEAIVVTQEVDDIISSPVV 719 Porphyromonas g...
WP_011107104 638 KDHKILFPITTIIIMEVFISKMRKLKGIRKLILIEEAWKAIASANMADYIKYLYKTVRKYFGEAIVVTQEVEDIISSPIV 717 Bacteroides
WP_012457210 637 KDHPILFPITTIIIMELFINKMRRLKGIRKVILIEEAWKAIASANMAGYIKYLYKTVRKFFGEAVVVTQEVDDIISSDIV 716 Porphyromonas g...
WP_010992657 640 KDNAELFPVVTIIIMEAFINKLRRLKGVRKMLICEEAWKALSSPSMSEYLKYLYKTVRKYFGEAIVVTQEVDDIISSPIV 719 Bacteroides fra...
WP_012025040 637 KDHKILFPIVTIIIMEVFINKMRRLKGVRKLILIEEAWKAIAKEGMAEYIKYLFKTVRKFFGEAIVVTQEVDDIIKSPIV 716 Flavobacterium ...
WP_008675208 639 SGNKVLLPVVTLIIMETFIAKMRRLKGIRKMILIEECWKALMSANMSEYIKYLFKTVRKYFGEAVVVTQEVDDIISSPIV 718 Bacteroidales
WP_005874655 720 KESIINNSDCKILLDQRKYANKFDQIQNLLGLTDKEKSQILSINMdNDPSRLYKEVWIGLGGTQSAVYATEVSAEEYLCY 799 Porphyromonas g...
WP_011107104 718 KESIINNSDCKILLDQRKYLNKFDSIQNLLGLTDKERSQMLSINLaNHPNRKYKEVWIGLGGTQSAVYATEVSLEEYFTY 797 Bacteroides
WP_012457210 717 KESIINNSDCKILLDQRKYMNKFDQIQALLGLTDKERGQILSINQsNDATRSYKEVWIGLGGVQSAVYATEVSKAEYLTY 796 Porphyromonas g...
WP_010992657 720 KEAIITNSDCKILLDQKKYMNKFDGIQSMLGLTDKEKSQILSINLaNHPGRKYKEVWIGLNGVQSAVYATEVSAAEYLTY 799 Bacteroides fra...
WP_012025040 717 KESIINNSDCKILLDQRKYMNKFDDIQAMLGLTDKEKAQVLSINMnNSPSRLYKEVWIGLGGTQSAVYATEVSLEEYLAY 796 Flavobacterium ...
WP_008675208 719 KEAIINNSDCKILLDQRKYMNKFEHIQRLLGLTEKEKGQILSINQaNHPGRFYREVWIGLGGTHSAVYATEVSGEEYYTF 798 Bacteroidales
WP_005874655 800 TTEETEKMEVLRLAEKSGGHIEQAIRQLAETK 831 Porphyromonas gingivalis
WP_011107104 798 TTEETEKMELFALSEKLGGNLELAIKRLAESK 829 Bacteroides
WP_012457210 797 TTEETEKMRVLARAEQLGGNMELAVRQLAEEE 828 Porphyromonas gingivalis
WP_010992657 800 TTEESEKTEVFALAEELGGDLELAIKRLAETK 831 Bacteroides fragilis
WP_012025040 797 TTEETEKMEVMQAAAELDGNVELAIRHIAKLR 828 Flavobacterium johnsoniae
WP_008675208 799 TTEESEKMEVQRLAERLDGNLELAVRHLAEKM 830 Bacteroidales
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap