Conserved Protein Domain Family
Bac_Flav_CT_N

?
TIGR03780: Bac_Flav_CT_N 
Bacteroides conjugative transposon TraN protein
Members of this family are the TraN protein encoded by transfer region genes of conjugative transposons of Bacteroides. The family is related to conjugative transfer proteins VirB9 and TrbG of Agrobacterium Ti plasmids. [Cellular processes, DNA transformation]
Statistics
?
PSSM-Id: 163492
View PSSM: TIGR03780
Aligned: 10 rows
Threshold Bit Score: 320.109
Threshold Setting Gi: 496040708
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_008024669   5 MKKILmMFFALMTGVTAASAQlssgdfF-------------EGLSRKIGFSRMIAPHGLEITYDKTVHVIFPSPIKYVDL 71  Bacteroides
WP_008675218   1 MRKIL-MMFALLTGFMAAYAQ------Qsgg-------dyfEGLSRKIGFSRMIPPHGLEITYDKTVHVIFPSPIKYVDL 66  Bacteroidales
WP_011107097   1 MKKLI-IMFALLLGVVSMKAQ------Snd---------lyQGITKKLPYRQMVTPYGVQVTFAKTVHIIFPSAVKYVDL 64  Bacteroides the...
WP_011202372   1 MKQIF-VLLALLLGVCAANAQ------TtdtvkyaagndlyRGITRKLPYRQMVTPYGVEVTFAKTVHIIFPAAVRYVDL 73  Bacteroides fra...
WP_009040010   1 MKTRIiLSLVILLTVLSVKAQ------E-------------PVETKIFPTNQIISPHKIEVTFQKTVHILFPSEVKYVDL 61  Bacteroides
WP_008463834   1 MKRYYeKYWTAVLAVLCVQLC------F---------------PQSSLPVMDEIKACRLGITYDKTSHLIFPSEIRYADL 59  Flavobacterium
WP_012026323   1 MKRANyLFLISLLLVCVSVNP------Q---------------SNARETVFYEDQYKNLKIGFSKTTSIIFPYTIKSIDK 59  Flavobacterium ...
WP_012025519   1 MKKYNlIYFISFSFLAISSFA------Q---------------LNNRKTNSNADNLVNLNIGYSKTTSLVFPYAIKSIDK 59  Flavobacterium ...
WP_004310170   2 KRNLFgIMLLSGISILPKANA------Q-------------------TTYEEMEQ---LTVNEQITTVITASEPVRFVDI 53  Bacteroidales
WP_008765215   1 MRKIF-IALCTMVSVITGNAQ------Nt-----------pIGENIELAGENPEELKVIYINKDVSTHFIAMEDIKYVDI 62  Bacteroides
WP_008024669  72 GSTNLIAGKADAAENVIRVKAAKKHFRDETNMSVIT-EDGNFYT-FNVRYADEPLLLNVEMCDFIHDGETVNrpnnamei 149 Bacteroides
WP_008675218  67 GSTNLIAGKADGAENVIRVKAARKHFRNETNMSVIT-EDGNFYT-FNVKYADEPLLLNVEMCDFIHDGETVNrpnnamei 144 Bacteroidales
WP_011107097  65 GSNYIIAGKADGAENVVRVKATTEGFPGETNFSVIC-EDGSFYS-FNAKYAHEPEMLNIEMKDFLENEDTTDfshtrmni 142 Bacteroides the...
WP_011202372  74 GSNHIIAGKADGAENVIRVKATTEGFPGETNFSVIC-EDGSFFS-FNAKYAREPEMLNIEMKDFLENEDTSDfshtrmni 151 Bacteroides fra...
WP_009040010  62 GSFDIIADKATGAENVVRIKAAVKGFEGETNFSVIT-ADGCFYS-FNVVYKDEPAQLSIEMEDWLRDNPEGG-------- 131 Bacteroides
WP_008463834  60 GSGLLMAAKAEDANNVLRVKAAVRDFEQQTNLSVIT-TDGRFYS-FDVHYDPNPKILGYNIGANGNAGSQST-------- 129 Flavobacterium
WP_012026323  60 GSAEVLVQKAKGVENILLVKAAKQHFFQ-TNLTVVT-SDGKLYV-FVLNYDDSCPDLNFKAENAVAASRDV--------- 127 Flavobacterium ...
WP_012025519  60 GSPDIIMQKAKGVENILLLKANRQNFAQ-TNLTIIT-ADSRLYV-FVLNYNDDCPDLNVNADNLAVVNDD---------- 126 Flavobacterium ...
WP_004310170  54 STDKVAGDQP--IDNIIRLKPKESGHEDGEILAIVTiVTERYRTqYALIYTTRMKEAVTDKEILLQERNA---------- 121 Bacteroidales
WP_008765215  63 SVNDIVGDIPTG--NSLRIKPTKEGASG-----VITiVTERFFVqYMLVYSSDLAKAYTRFNIPYADLRS---------- 125 Bacteroides
WP_008024669 150 Y--------LQELGNESPRLVRLIMKSVHRQDKRRVRHIGCKRFGVQFLLRGLYTHNDLLYFHTQLRNETNVPFDVDFVT 221 Bacteroides
WP_008675218 145 Y--------LQELGSESPRLVRLIMKSVHKQDKHWIKHIGCKRFGVRFLLKGLYTHGDLLYFHTEVRNATHVPFDVDFVT 216 Bacteroidales
WP_011107097 143 Y--------FRELGNESPLLVKLIMQSIYKNNDREIKHLGCKRFGVQFLVKGIYSHNGLFYFHTQTKNSSNVPFDTDFIR 214 Bacteroides the...
WP_011202372 152 Y--------FRELGNESPLLVKLIMQSIYKNNDRKVRHLGSKRFGIQFLIKGIYTYNGMLYVHTQTKNSSNVPFDTDFIR 223 Bacteroides fra...
WP_009040010 132 IagdrmfvkLKELGGETPLVVNRIMYTLYKKNKRDIRHIGCKKYGIQTLLKGLYINNDLLYLHTSLRNSSDISFDIDYIR 211 Bacteroides
WP_008463834 130 L--------FEELGESSPSTAESVMKRIYDNDKRVIRHIRTRNAGAEFRLNGIYVHDGKYYFHIALYNSTNVPYRIDFLN 201 Flavobacterium
WP_012026323 128 ---------LFSLENENQKRIEQCALAAYSKKKKISG-LKKSKYQIRLEVNGIFIQQDVLYLRIVFENKSKINYDIDQLR 197 Flavobacterium ...
WP_012025519 127 I--------LFSKENENQKKIEQFAALA-LAKKKKITGIQRSKFDIKLSVSGIFIHEDVMYFRLVIDNNSKINYELDQLR 197 Flavobacterium ...
WP_004310170 122 Y--------NNPAVSMSAADMTHHARRIW-NSPAKIRNVATKAHRMVMRLNNIYSVGDYFFIDFSIENKTNIRFDIDEIR 192 Bacteroidales
WP_008765215 126 Y--------MNPEVNLTKAQMYDYAHRMF-ISKNKFYDVSSTSNLMKIVLNNIYTLDKYFFIDISMINKTKIRYDIDQIR 196 Bacteroides
WP_008024669 222 FKIVDKKIVKRTAMQEQVIYPLRACNYVTRVDGKASERTVFALPKFTIPEDKKLVVEMYEKQ-GGRHQMFEVDNESLVRA 300 Bacteroides
WP_008675218 217 FKIVDKKIVRRTAMQEQVIYPLRAFNYVIRVEGKKDERTVFALPKFTIPDDKKLVVEMYEKQ-GGRHQIFEVDNEDLVRA 295 Bacteroidales
WP_011107097 215 FKIVDKKVAKRTAIQETVIDPVRSYNEILVIGGKSTVRTVYTVPQFTIPDDKILVIELVEKN-GGRHQTIRVENSDVVAA 293 Bacteroides the...
WP_011202372 224 FKITDKKVPKRTAIQETVLDAVRSYNEVIEIAGKSTVRTVYALPKFTIPDDKLLVVELYEKN-GGRHQTIRVENADIVNA 302 Bacteroides fra...
WP_009040010 212 FKVVDKKVAKRTAMQENFIEPVRTYNRLITVDGKATVRGIFVLPKLTLPDDKLLVVEVYEKG-GARHQSFRIENTDLVAA 290 Bacteroides
WP_008463834 202 FKIADRNKARRTAVQQKAISPLRVYRPAGEIKAGGSERCVYVLDLFTLTDGKLLLIEIYEKN-GGRQQTLKIKNSDLLKA 280 Flavobacterium
WP_012026323 198 FFIRDQKKSKRTASQEIELQPLYVTSSSSVIPYKSEIIKVYALEKFTIPENKYLTLQMIEKN-GGRHLEVDINNNLTDKV 276 Flavobacterium ...
WP_012025519 198 FFIRDKKKAKRTASQEIEIIPLYDSNSRNVIAAKSEWTAVYAMPKVIIPEKKYLTIQLIEKN-GERQLEVDINNNLTKKI 276 Flavobacterium ...
WP_004310170 193 IKLTDKKLAKATNAQTIELTPALVLESGKTF--RHGYRNVIVVKKMTFPNDKLLTIEMTEKQiSGRNISLNIDYEDILAA 270 Bacteroidales
WP_008765215 197 FKIEDKKQTKATNFQSIEILPLMQVNKNLVF--KKNYRNIFVFEKFTFPDEKVLTIEISEKQiSGRTITLRIDYADILHA 274 Bacteroides
WP_008024669 301 EPV 303 Bacteroides
WP_008675218 296 ETI 298 Bacteroidales
WP_011107097 294 KVI 296 Bacteroides thetaiotaomicron
WP_011202372 303 EVI 305 Bacteroides fragilis
WP_009040010 291 KPI 293 Bacteroides
WP_008463834 281 CLP 283 Flavobacterium
WP_012026323 277 IPI 279 Flavobacterium johnsoniae
WP_012025519 277 SAI 279 Flavobacterium johnsoniae
WP_004310170 271 DSF 273 Bacteroidales
WP_008765215 275 DAF 277 Bacteroides
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap