Conserved Protein Domain Family
RPE5

?
TIGR03776: RPE5 
Rickettsial palindromic element RPE5 domain
This model describes protein translations of a family, RPE5, of Rickettsia palindromic elements (RPE). The elements spread within a genome as selfish genetic elements, inserting into genes additional coding region that does not disrupt the reading frame. This model finds RPE-encoded regions in several Rickettsial species and, so far, no where else.
Statistics
?
PSSM-Id: 163488
View PSSM: TIGR03776
Aligned: 8 rows
Threshold Bit Score: 54.4733
Threshold Setting Gi: 499590719
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011271406   6 MKRSHTKINLEKSKEFVS-RGAERTKVREHPRTYKEDVANFSSS 48  Rickettsia felis
WP_011270378 115 MQSDYMKINLEKSNRSVS-RGAERTEVREHPRTYKDDVANFGGS 157 Rickettsia felis
WP_011477898 355 IKSNYTKFNLEKSKESVS-RGAERIKIREHLRTYKEDVANFSSS 397 Rickettsia bellii
WP_011190639   1 MKHPDTKNNLQEINDSVS-RAAVHTKMHGHPKTYKDNIANFLSS 43  Rickettsia typhi
WP_011190839  55 IKNCYTTFKFEKSNRSII-TRAERIINVQHLRRCKDIVDNFSGL 97  Rickettsia typhi
WP_004595913   1 MKHSDTKNNLQEINESVS-RSAVHTKIHEHPKIYKDNIENFLSS 43  Rickettsia prowazekii
WP_010886281  55 IKNCYTTFKFEQSNRFII-TKAERIIKIQHLIRFKDIVNNFISL 97  Rickettsia prowazekii
WP_011271478 252 EDTGYT-VDTSKVGSQISgEPAERIIIREHRRVPKFDVPNLEVS 294 Rickettsia felis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap