Conserved Protein Domain Family
RPE3

?
TIGR03775: RPE3 
Rickettsial palindromic element RPE3 domain
This model describes protein translations of a second family, RPE3, of Rickettsia palindromic elements (RPE). The elements spread within a genome as selfish genetic elements, inserting into genes additional coding regions that does not disrupt the reading frame. This model finds RPE-encoded regions in several Rickettsial species and, so far, no where else.
Statistics
?
PSSM-Id: 163487
View PSSM: TIGR03775
Aligned: 15 rows
Threshold Bit Score: 58.5426
Threshold Setting Gi: 499504498
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_010977195 265 LQHNSESFRQDEFQGEPAEpeCIKIREHRQDLQNSLVSSFMHYAV 309 Rickettsia conorii
WP_012151586  94 IQLNSESFRQDEFKEEPAE--HIIIREQRRMPQNSLVSSLLNDAV 136 Rickettsia bellii
WP_011270499 274 TQLNLKSFRQDEFKEEPAE--HTKVREHRLYPQNSLGSSFLNDAI 316 Rickettsia felis
WP_011271299 357 kQLNSESFRQDEFKSKPAE--RTIVREHRLDSKNSPVSSFLNDAV 399 Rickettsia felis
WP_011271381 443 LQLNSKGFRQDEFKDESAQ--RILIREHRRVPQNSLVSSLLNDAV 485 Rickettsia felis
WP_004596647 274 TKLNLKSFRKDEFNWKPLE--CITRPKYRIHIQNSYRSNLLNDTI 316 Rickettsia prowazekii
WP_010977032 175 VQLNLDRFRQDEFQDKPAE--RTNVREHRRMPQNSLVSSDRNLAV 217 Rickettsia conorii
WP_016926144 378 LQLNSESFRHDEFKGKLAR--CTKVREHRLSLENSLVSSDRDDAV 420 Rickettsia conorii
WP_011190566 274 TNLNLKSFRQDEFNLNHLQ--DITRPKSRIYLQNSFRSNLLNDTI 316 Rickettsia typhi
WP_014419392  96 IDQSLRSFKQDEFSNKFTK--NVIVHEHKPNSKNSYLSTFMNSTV 138 Rickettsia typhi
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap