Conserved Protein Domain Family
RPE2

?
TIGR03774: RPE2 
Rickettsial palindromic element RPE2 domain
This model describes protein translations of a second family, RPE2, of Rickettsia palindromic elements (RPE). The elements spread within a genome as selfish genetic elements, inserting into genes additional coding regions that does not disrupt the reading frame. This model finds RPE-encoded regions in several Rickettsial species and, so far, no where else.
Statistics
?
PSSM-Id: 163486
View PSSM: TIGR03774
Aligned: 9 rows
Threshold Bit Score: 64.8478
Threshold Setting Gi: 75535997
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q92ID7        67 VVNSVGLGHKEQGAK-PITNRRTTSDNVGESKSIDY 101 Rickettsia conorii str. Malish 7
Q4UK70        55 IVNSASFAYKEPRVE-PITNRRATSDIVSEGGSIDY 89  Rickettsia felis URRWXCal2
Q4ULU8       759 IVNSVGLGYKARGAT-PIIIGETTSNDVGKPKSIDY 793 Rickettsia felis URRWXCal2
WP_011477160  48 IVNSVKLEYKERGAK-PINNRRATSDDVGEFKSIDY 82  Rickettsia bellii
WP_012148727 216 IVNSVGFGYKERETK-PITNRRATSNIVGESKSIDY 250 Rickettsia canadensis
WP_011270375 143 IVKSVGFNYKERGAK-PITNRRATSDDGSEFKSFDY 177 Rickettsia felis
WP_016926311 100 VVNSASFGYKEQGAKkPITNRRATSDEVGVWVSLDY 135 Rickettsia conorii
WP_014273555  34 IVNSVEFGYKERGAK-PIIIGETTSNAVGESKSIDY 68  Rickettsia slovaca
WP_012148621  97 IVNAALSGYKEQGAK-PITNRKVTNGTIGMLKSIDY 131 Rickettsia canadensis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap