Conserved Protein Domain Family
anch_rpt_subst

?
TIGR03772: anch_rpt_subst 
anchored repeat ABC transporter, substrate-binding protein
Members of this protein family are ABC transporter permease subunits as identified by pfam00950, but additionally contain the Actinobacterial insert domain described by TIGR03769. Some homologs (lacking the insert) have been described as transporters of manganese or of chelated iron. Members of this family typically are found along with an ATP-binding cassette protein, a permease, and an LPXTG-anchored protein with two or three copies of the TIGR03769 insert that occurs just once in this protein family. [Transport and binding proteins, Unknown substrate]
Statistics
?
PSSM-Id: 163484
View PSSM: TIGR03772
Aligned: 4 rows
Threshold Bit Score: 775.962
Threshold Setting Gi: 499236761
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_028564638  39 QVITTTGILRDLVSNVGGDQVAVSSLVRDGADPHSYEPSLRDIRDVVYADVAFSNYLLLEEQAIIKALDANLREGVPNIS 118 Salinispora tro...
WP_002516883  29 SIVTTTPILADLTRQVAGDRATVTSMVPSGADPHTYEPSLRDVRTVVYSRVALSNYLMLEPHSVIKTIDSSLPTGSINVS 108 Propionibacterium
WP_011274185  48 DVVASTPIIADIARHVAGDAARVTALIPNTADPHTYELTLRDVRNLANADIAFNNGLLLEQQSVLRTMDNGVLPGTEVVA 127 Corynebacterium...
WP_010934301  30 EVVATTPIVADLVRHVAGERAEVTALMPPGVDPHTYEPRLRAVRDIANADIAFTNGLLLEPHSLSTTIEEALPDNAPMVP 109 Corynebacterium...
WP_028564638 119 LAEGAVKYAAEIIPLVEDVSLDTIWLGMRVRGTGAVHGANRASDVLLSATSADGPGDVVAYLTGSFGNPSVYIDSTDGFD 198 Salinispora tro...
WP_002516883 109 LAEEAQKYGAQVIPLVENANLDTVWLGLRVIGKGARRGSDRSSSVHLQLTSVEGPGDLTAYITGTFGRPQIYYSTADGVD 188 Propionibacterium
WP_011274185 128 LADVAANQGATVIPLVENMALDTVWLGLRAQGIGARHGGSAHSEVHLSVTDVEGPGDAAAYITGTFGQPEIFFNSRDGFD 207 Corynebacterium...
WP_010934301 110 LAEQVTSYGGKLKPLVENIALDTVWLGMRIVGK-----ADSEVEIVTEKIDAPEDSKATAYITSTFGVPELVFDE----- 179 Corynebacterium...
WP_028564638 199 pangfRADTAMLPPDAHTHMSWAFTKPGIYRLSMRAQLSVDPQApsVPMGEQVFTFAVGVDPHSVPGMPAATVLSAGHAD 278 Salinispora tro...
WP_002516883 189 -----ERDDVELPTDAHTHMSWAFSKPGVYKAVFAATLSTPQGN--ASFGAQTLTIAVGADPRTIPELADRTVVDQGHAD 261 Propionibacterium
WP_011274185 208 asrgyEGDTATLPVDAHTHMSWSFSKPGTYTLHLSASLVPDEGKppEHIADQTVRFTVGTED------GASKKIDSGHYD 281 Corynebacterium...
WP_010934301 180 -----EGDNYFLPADAHTHVSWSFSKPGMYHLTFAAKV---KGK---LVARNTINVAVGVD-------APNDVLDEGHVD 241 Corynebacterium...
WP_028564638 279 LTVDLDQQRLYLFAD-PEGSGEAKQQVYDPARTVIEVPSKALLEVPGDRRLRFLGRPGSRVYQLPQAVLGKHVHGEIDPH 357 Salinispora tro...
WP_002516883 262 LSADIDEGTMTILSD-PTGGGVRTQKRLDPDKTVVWVPPKALTEIPPSPAFRFLGHPGSPIHQLPQAVLGAHVHGEIDPH 340 Propionibacterium
WP_011274185 282 IAVNADDNSINLVGD---GGTI------DPKKAVVSVPNQTLQPIPGDPNFRFLGTAGDETYLLPQAVLGKHVHGELDPH 352 Corynebacterium...
WP_010934301 242 IAVDLAHKNIMLRGDsPDGTNIAYD--YDPATTTISVPNSTLQQIPAQ--YRFMGRPGDEVYLLPQAVLGKHVHGEVDPH 317 Corynebacterium...
WP_028564638 358 LWQNVRNAISYTELIRDTLIEVDPRGAAAYRSNASAYIHRLEQLDTYMRNTIADIPPSQRHLITTHDAFSYLGQAYGVNI 437 Salinispora tro...
WP_002516883 341 LWMSIKNTKAYVQVIRDSLIKADPHEAQTYRENAKRYLTRLEETSHYVDRKIASIPRGRRQLITSHDAYGYLAQAHGMHI 420 Propionibacterium
WP_011274185 353 LWHNAKNAMAYVKVIRDKLIAVDPEHAADYQQNARTYLDELDRLDREIKRQVDTIPEARRHLVTAHDGYAYFAVAYGLDV 432 Corynebacterium...
WP_010934301 318 VWHNMANARAMVEAIRDKLSEVDPAGAQIYSANAAAYIAEIDRVNNEVRMILDTIPKKNRHLVTTHDGYSYLGDAYGLSI 397 Corynebacterium...
WP_028564638 438 SGFVAPNPAVEPSLADRRRLTETIRNLKIPAVFLEPNLAARSTTLNEVAREEGLRVCAIYGDTFDRDITNYVQMMRFNAD 517 Salinispora tro...
WP_002516883 421 AGFVTANPGVEPSMAQRRKLNQTIADLKVPAVFLEPNVLRGSSVLAAIAAENSVTVCPIYGDTFDDHVTNYIDLMRFDAD 500 Propionibacterium
WP_011274185 433 AGFVTPNPEIEPSTRDLVSLTRTLENLKVPAVFIEPTMAGRTRELQQIADRLGVSVCQIRSDTLDDTAPTYVDLMRTNAE 512 Corynebacterium...
WP_010934301 398 AGFVSPNPSVEPSPRDIIALTRTLENLHVPAVFIEPQLALRANHLTVTADKLGIQVCRIYGDSLDDEVPTYLDFMKYNAH 477 Corynebacterium...
WP_028564638 518 SLRDCLT 524 Salinispora tropica
WP_002516883 501 SLAKCLG 507 Propionibacterium
WP_011274185 513 SMANCLS 519 Corynebacterium jeikeium
WP_010934301 478 SLARCLG 484 Corynebacterium diphtheriae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap